Protein Info for DVU3033 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: iron-sulfur cluster-binding protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 717 transmembrane" amino acids 334 to 351 (18 residues), see Phobius details PF02589: LUD_dom" amino acids 70 to 294 (225 residues), 184 bits, see alignment E=5.3e-58 PF13183: Fer4_8" amino acids 310 to 377 (68 residues), 45.7 bits, see alignment E=1.6e-15 PF13534: Fer4_17" amino acids 312 to 378 (67 residues), 30.3 bits, see alignment E=9.8e-11 PF02754: CCG" amino acids 476 to 559 (84 residues), 58.2 bits, see alignment E=1.5e-19 amino acids 609 to 693 (85 residues), 54.6 bits, see alignment E=2e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU3033)

MetaCyc: 100% identical to quinone-dependent L-lactate dehydrogenase large subunit (Desulfovibrio vulgaris)
L-lactate dehydrogenase (cytochrome). [EC: 1.1.2.3]

Predicted SEED Role

"Predicted L-lactate dehydrogenase, Fe-S oxidoreductase subunit YkgE / Predicted L-lactate dehydrogenase, Iron-sulfur cluster-binding subunit YkgF" in subsystem Lactate utilization or L-rhamnose utilization

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.2.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q726S3 at UniProt or InterPro

Protein Sequence (717 amino acids)

>DVU3033 iron-sulfur cluster-binding protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MQNSKTLKEYRKELQESLDNEFLRNAMDKFAVAYRASRANAFKDIDEKAIIAEVADAKDH
AAKNMDTLYAQFKAEAEKRGVKVHLARTAAEANEIIARIARDNNCKKAIKSKSMTAEETH
LNHRLEEDNVEVIETDLGEWIIQMRHEGPSHMVMPAIHLSRYQVADLFSEVTKQKQEVDI
QRLVKVARRELRTHFATADMGISGANFAVAETGTIGLVTNEGNARLVTTLPRVHVALAGL
DKLVPTLHDALRSLKVLPRNATGQAITSYVTWIGGANECEACVDGRKEMHIVFLDNGRRA
LAEDPLFSQVLRCVRCGACANVCPVYRLVGGHKMGHIYIGAIGLILTYFFHGRDKARNLV
QNCINCESCKHICAGGIDLPRLIKEIRARLNEEEGMPVETTLMGKMLKNRKLFHTLLRFA
KWAQKPVTGGTPYIRHLPQIFAKDHGFKALPAIADKPFRDEWETVRPRIAKPKLRIALFS
GCVQDFVYPEQMKAAVKVIASQNVDIDFPMDQSCCGLPVQMMGEREATIEVARQNVMAFD
AARYDYIVTLCASCASHLKETYPKLLTGHPEMTTRVRQFSNKIIDFSSFVHDVLGMKSDA
FKGGSNEKVAYHSSCHLCRGLGVVEQPRNLIAASGATYCKAEEEDVCCGFGGTFSAKFPE
LSAELLRKKLDNVEATGAGRLVADCPGCIMQLRGGMEKRGGKVKVGHVAELLAENLK