Protein Info for DVU2973 in Desulfovibrio vulgaris Hildenborough JW710

Name: hup
Annotation: integration host factor, beta subunit (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 91 PF00216: Bac_DNA_binding" amino acids 1 to 90 (90 residues), 104 bits, see alignment E=2e-34

Best Hits

Swiss-Prot: 40% identical to DBH1_BACSU: DNA-binding protein HU 1 (hupA) from Bacillus subtilis (strain 168)

KEGG orthology group: K05788, integration host factor subunit beta (inferred from 100% identity to dvl:Dvul_0397)

Predicted SEED Role

"Integration host factor beta subunit" in subsystem DNA structural proteins, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q726Y3 at UniProt or InterPro

Protein Sequence (91 amino acids)

>DVU2973 integration host factor, beta subunit (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MNKSELVKMLAENHEIPAEESSVIVNLFFDSVRDALLQGDRVEIRGFGSFKVKGYRGYKG
RNPKTGDNVEVPPKRLPVFRAGKELKEIINP