Protein Info for DVU2951 in Desulfovibrio vulgaris Hildenborough JW710

Name: glnS
Annotation: glutaminyl-tRNA synthetase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 570 TIGR00440: glutamine--tRNA ligase" amino acids 39 to 564 (526 residues), 782.9 bits, see alignment E=8.8e-240 PF00749: tRNA-synt_1c" amino acids 39 to 347 (309 residues), 377.1 bits, see alignment E=8.4e-117 PF03950: tRNA-synt_1c_C" amino acids 351 to 450 (100 residues), 107.5 bits, see alignment E=5e-35 PF20974: tRNA-synt_1c_C2" amino acids 467 to 542 (76 residues), 76.9 bits, see alignment E=2.3e-25

Best Hits

Swiss-Prot: 64% identical to SYQ_NITHX: Glutamine--tRNA ligase (glnS) from Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)

KEGG orthology group: K01886, glutaminyl-tRNA synthetase [EC: 6.1.1.18] (inferred from 100% identity to dvl:Dvul_0417)

MetaCyc: 61% identical to glutamine--tRNA ligase (Escherichia coli K-12 substr. MG1655)
Glutamine--tRNA ligase. [EC: 6.1.1.18]

Predicted SEED Role

"Glutaminyl-tRNA synthetase (EC 6.1.1.18)" in subsystem tRNA aminoacylation, Glu and Gln (EC 6.1.1.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q727A5 at UniProt or InterPro

Protein Sequence (570 amino acids)

>DVU2951 glutaminyl-tRNA synthetase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSEQNPNVSERTTEATPGLDFVRSRVVADNRTGRFDGRVHTRFPPEPNGYLHIGHAKSIC
LNFGIANEYGGKCNLRFDDTNPVKESREYVDSIRTDVAWMGFSWDDREFYASNYFEQLYQ
FAEQLIMAGKAYVDSLSAEEIRAHRGTLTQPGTESPYRNRSVEENLDLFRRMRAGEFADG
THVLRAKIDMASPNVVMRDPTLYRIRHAHHHRTGDAWCIYPMYDFTHCISDSLEGITHSI
CTLEFENNRELYDWTLDALGVYHPQQIEFARLNLTYTVLSKRKLIQLVEGGFVKGWDDPR
MPTISGLRRRGVPPEALREFCARIGVAKADSTVDYGLFEFCIRERLNATTPRVMGVLDPI
RVVIENYPEGQVEEFDMPYHPEDASFGSRIVPFSRVLYIERDDFREDPPKKFFRLAPGAE
VRLRYAYYITCREVVKDEAGNIVELRCTYDPESRGGSSPDGRKVKGTLHWVSAAHAVESE
VRLYEQLFAVSDPDDVPEGGVFTDNLNPDSLKVVRAMLEPSLGGIEPGTKVQFERMGYFC
ADPDSVPGAPVFNRTVTLKDTWAKLEKKMG