Protein Info for DVU2937 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: TPR domain protein/response regulator receiver domain protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 451 PF00072: Response_reg" amino acids 31 to 146 (116 residues), 36.9 bits, see alignment E=2.5e-12 PF13181: TPR_8" amino acids 192 to 216 (25 residues), 19.3 bits, see alignment (E = 6.9e-07) amino acids 371 to 401 (31 residues), 13.9 bits, see alignment (E = 3.7e-05) PF13374: TPR_10" amino acids 335 to 364 (30 residues), 20.9 bits, see alignment (E = 2e-07) PF13424: TPR_12" amino acids 336 to 398 (63 residues), 32.6 bits, see alignment E=5.3e-11 PF07719: TPR_2" amino acids 338 to 368 (31 residues), 27.7 bits, see alignment (E = 1.3e-09) PF13176: TPR_7" amino acids 338 to 369 (32 residues), 22 bits, see alignment (E = 8.7e-08) PF13432: TPR_16" amino acids 340 to 401 (62 residues), 24.9 bits, see alignment E=1.7e-08 PF13414: TPR_11" amino acids 344 to 378 (35 residues), 29.4 bits, see alignment 3.6e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvl:Dvul_0431)

Predicted SEED Role

"TPR domain protein/response regulator receiver domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q727B8 at UniProt or InterPro

Protein Sequence (451 amino acids)

>DVU2937 TPR domain protein/response regulator receiver domain protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MASDINAKLRQKQYEAAVLEFAGDRKGYFVVASDDPQFASLLRQTLTKHLAIPGDAMSTV
ANPDHILRELKNVTMRRKTVLLFLERILEGRDTNLLVRQLKSAYPDLKIIVITGETERNR
LVLLHEVGADNFITKPVSMNTLIEKMAFTIKPLGKLGQLIDQAREFVHQNLPEQGIKLCR
QILELKPGSAAGYLVMGEAYQHLGKLDKARECYEEASRNAELYLEPLRRLADIHGEMGEP
TEQLRYLERLDQLSPLNVERKVDMGAIHLELGNQEKADELFDTAVQQATREALSYIADIS
GRIAGIYNGRDPQRAEHFLRRALDAKGDMLDASDLDTFNRLGIALRRQGKWQEALTEYHK
ALRVAPEDENLFYNMGMACAEGRDFREARANMLKALTINPELPRRDPVMAYNIGLVFMRA
GGREYAERCLNIALELDPGFTKAREALERLG