Protein Info for DVU2932 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: conserved hypothetical protein TIGR01777 (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details PF01370: Epimerase" amino acids 3 to 222 (220 residues), 70.9 bits, see alignment E=2.3e-23 TIGR01777: TIGR01777 family protein" amino acids 3 to 295 (293 residues), 290.9 bits, see alignment E=6.6e-91 PF03435: Sacchrp_dh_NADP" amino acids 4 to 74 (71 residues), 29.9 bits, see alignment E=1.3e-10 PF13460: NAD_binding_10" amino acids 7 to 120 (114 residues), 41.6 bits, see alignment E=2.5e-14 PF08338: DUF1731" amino acids 257 to 304 (48 residues), 55.1 bits, see alignment 9.8e-19

Best Hits

Swiss-Prot: 43% identical to YFCH_ECOLI: Epimerase family protein YfcH (yfcH) from Escherichia coli (strain K12)

KEGG orthology group: K07071, (no description) (inferred from 100% identity to dvu:DVU2932)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q727C3 at UniProt or InterPro

Protein Sequence (308 amino acids)

>DVU2932 conserved hypothetical protein TIGR01777 (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MRIVIAGGSGFIGRALADALVARGDEVTVPTRSPDRAGRVLPPAVTAAAWDGLDPDALAT
IIDGADAVVNLVGANIAEGRWTPAVKRSIVESRVQAGRALAEATHRATTAPHVVVQGSAV
GYYGGWSDMLTAPVSAEDAPCGAGFLAETCQQWEASSSDVAEGVRHCVFRTGVVLGKGGA
LAKMLPPFRLFAGGPPGTGRQPFAWIHLSDEVRAIVHLIDHATLSGPFNLTAPGCISMAD
FCHALGKVLHRPSFTRVPAPLLRLMLGEMAEEVLLRGQVAPPERLLASGFSFTHTAPIPA
LEDILRRR