Protein Info for DVU2923 in Desulfovibrio vulgaris Hildenborough JW710

Name: nusG
Annotation: transcription antitermination protein NusG (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 183 PF02357: NusG" amino acids 11 to 114 (104 residues), 100.8 bits, see alignment E=5.1e-33 TIGR00922: transcription termination/antitermination factor NusG" amino acids 12 to 182 (171 residues), 216.8 bits, see alignment E=8.9e-69 PF00467: KOW" amino acids 132 to 164 (33 residues), 30 bits, see alignment 3.3e-11

Best Hits

Swiss-Prot: 54% identical to NUSG_HAEIN: Transcription termination/antitermination protein NusG (nusG) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02601, transcriptional antiterminator NusG (inferred from 100% identity to dvl:Dvul_0444)

Predicted SEED Role

"Transcription antitermination protein NusG" in subsystem Transcription factors bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q727D2 at UniProt or InterPro

Protein Sequence (183 amino acids)

>DVU2923 transcription antitermination protein NusG (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MTETTTASKARWYIVHTYSGFENRVEQTIREMIRTGQSQDEIVEVVVPTEKVIELVKGEK
RTSTRKFYPGYVMVKMFMTDFSWHLVQSIPKVTGFVGGKNRPTPMRDSEAERILAMMESR
QEQPRPKFNFDRGDEVRVIDGPFGGFNGVVEDVNYDKGKLRVSVSIFGRQTPVELDFVQV
SKG