Protein Info for DVU2825 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: pyruvate formate-lyase 1 activating enzyme, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02494: glycyl-radical enzyme activating protein
  • amino acids 14 to 304 (291 residues), 383.4 bits, E=3.4e-119
• PF13353: Fer4_12
  • amino acids 23 to 57 (35 residues), 25.2 bits, 1.8e-09
  • amino acids 96 to 215 (120 residues), 25.5 bits, E=1.4e-09
• PF04055: Radical_SAM
  • amino acids 106 to 248 (143 residues), 54.5 bits, E=1.6e-18

Best Hits

KEGG orthology group: K04069, pyruvate formate lyase activating enzyme [EC: 1.97.1.4] (inferred from 100% identity to dvl:Dvul_0490)

Predicted SEED Role

"Pyruvate formate-lyase activating enzyme (EC 1.97.1.4)" in subsystem Fermentations: Mixed acid or Threonine anaerobic catabolism gene cluster (EC 1.97.1.4)

MetaCyc Pathways

• hexitol fermentation to lactate, formate, ethanol and acetate (16/19 steps found)
• pyruvate fermentation to acetate IV (3/3 steps found)
• pyruvate fermentation to ethanol I (3/3 steps found)
• reductive monocarboxylic acid cycle (2/2 steps found)
• superpathway of fermentation (Chlamydomonas reinhardtii) (7/9 steps found)
• mixed acid fermentation (12/16 steps found)
• superpathway of N-acetylneuraminate degradation (15/22 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (7/13 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.97.1.4

Use Curated BLAST to search for 1.97.1.4

Sequence Analysis Tools

See Q727N0 at UniProt or InterPro

Protein Sequence (307 amino acids)

>DVU2825 pyruvate formate-lyase 1 activating enzyme, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSSIADRKTTGITFNIQKYSVHDGPGIRTVVFLKGCPLKCRWCSNPESQRKSVELAYNTG
RCLTLAKCVRCVEICTAGAISRAEDDTISIDRALCNDCEQLCSGACPSNALITYGAHKTV
DEVLRAVEQDSLFYARSGGGMTISGGEPFAQPAFTLALLREARRRRVHTAVETCGYASWD
DMAAALPFLNYVLYDIKNLDDARHKEATGVSNQRIVENLRALRAEFPGIPVLVRTPVIPG
FNDNEADIAAIAALTRELGVSYQLLPYHRLGTQKYHFLDREAPMGEVTLDAETMRRLEAV
VAQTADS