Protein Info for DVU2825 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: pyruvate formate-lyase 1 activating enzyme, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 TIGR02494: glycyl-radical enzyme activating protein" amino acids 14 to 304 (291 residues), 383.4 bits, see alignment E=3.4e-119 PF13353: Fer4_12" amino acids 23 to 57 (35 residues), 25.2 bits, see alignment 1.8e-09 amino acids 96 to 215 (120 residues), 25.5 bits, see alignment E=1.4e-09 PF04055: Radical_SAM" amino acids 106 to 248 (143 residues), 54.5 bits, see alignment E=1.6e-18

Best Hits

KEGG orthology group: K04069, pyruvate formate lyase activating enzyme [EC: 1.97.1.4] (inferred from 100% identity to dvl:Dvul_0490)

Predicted SEED Role

"Pyruvate formate-lyase activating enzyme (EC 1.97.1.4)" in subsystem Fermentations: Mixed acid or Threonine anaerobic catabolism gene cluster (EC 1.97.1.4)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.97.1.4

Use Curated BLAST to search for 1.97.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q727N0 at UniProt or InterPro

Protein Sequence (307 amino acids)

>DVU2825 pyruvate formate-lyase 1 activating enzyme, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSSIADRKTTGITFNIQKYSVHDGPGIRTVVFLKGCPLKCRWCSNPESQRKSVELAYNTG
RCLTLAKCVRCVEICTAGAISRAEDDTISIDRALCNDCEQLCSGACPSNALITYGAHKTV
DEVLRAVEQDSLFYARSGGGMTISGGEPFAQPAFTLALLREARRRRVHTAVETCGYASWD
DMAAALPFLNYVLYDIKNLDDARHKEATGVSNQRIVENLRALRAEFPGIPVLVRTPVIPG
FNDNEADIAAIAALTRELGVSYQLLPYHRLGTQKYHFLDREAPMGEVTLDAETMRRLEAV
VAQTADS