Protein Info for DVU2798 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: ApbE family protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF02424: ApbE" amino acids 43 to 317 (275 residues), 231 bits, see alignment E=9e-73

Best Hits

KEGG orthology group: K03734, thiamine biosynthesis lipoprotein (inferred from 100% identity to dvl:Dvul_0516)

Predicted SEED Role

"Thiamin biosynthesis lipoprotein ApbE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q727Q7 at UniProt or InterPro

Protein Sequence (336 amino acids)

>DVU2798 ApbE family protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MKTFSRRTFLGMAGLTGAGLCLGLPVGARAAQALPVTETRVQMGTYVGITVAGVSAMQAE
EALGRAFAEVARLEAVFSRFDGASPVSELNRAGRLPDAPAELVTLVDRARRYGSLTDGAF
DITVQPVVDLFRRNGNPRGTMHVDEADLKAARELVGLAHLQSGSGRLGFDRSGMGITLDG
IAKGHIADMASAVLTAHGVTDHIVNAGGDIMVRGMKAPGTAWRVAVASPNGGASYPETVR
LTECAIATSGTSEVYFDARHQHHHLITPVAGRSPASTGSVSVIAPTVMEADALATALSVI
PPQDALRLVASLPGRACCIFTRDGRRFTSSNWATFA