Protein Info for DVU2780 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: membrane protein, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 39 to 59 (21 residues), see Phobius details amino acids 65 to 82 (18 residues), see Phobius details amino acids 88 to 109 (22 residues), see Phobius details amino acids 115 to 134 (20 residues), see Phobius details amino acids 155 to 174 (20 residues), see Phobius details amino acids 180 to 202 (23 residues), see Phobius details PF02588: YitT_membrane" amino acids 20 to 222 (203 residues), 190.7 bits, see alignment E=2.1e-60 PF10035: DUF2179" amino acids 229 to 282 (54 residues), 57.8 bits, see alignment E=7.5e-20

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvl:Dvul_0531)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q727S5 at UniProt or InterPro

Protein Sequence (291 amino acids)

>DVU2780 membrane protein, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MMSLRLPSRQELAYSVWWNLFLLTAGSALFAAGAQGIAVHHGFLTGGVYGTALLLWYGTG
GFSPAAWYLLLNVPLFVLGWFCVGRRFFLYSLFGMLATTLFGEVLRFDFGITDQFYAAVA
CGVVCGAGGGMMLRSLGSGGGLDVVAVLLNRKWNIGIGRFGFVFNCVLFTASLATMQIDL
VIASLIQVFIASVTLEHVLSLFNQRKVVFIISDRSRAISSEITSALKQGATVLQGRGGYS
GDNREIVMTVTNNVQLKRLEELVFTLDAHALFIVENTFTVLGANFARRKVY