Protein Info for DVU2773 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: membrane protein, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 288 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 38 to 56 (19 residues), see Phobius details amino acids 61 to 79 (19 residues), see Phobius details amino acids 85 to 106 (22 residues), see Phobius details amino acids 112 to 133 (22 residues), see Phobius details amino acids 153 to 171 (19 residues), see Phobius details amino acids 177 to 196 (20 residues), see Phobius details PF02588: YitT_membrane" amino acids 17 to 219 (203 residues), 179.9 bits, see alignment E=4.2e-57 PF10035: DUF2179" amino acids 225 to 279 (55 residues), 61.4 bits, see alignment E=6e-21

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvl:Dvul_0536)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q727T1 at UniProt or InterPro

Protein Sequence (288 amino acids)

>DVU2773 membrane protein, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MLARRMRDVTMTVPWNLFLLTVGGVLFSLGLKSIAMPHAFISGGVFGTGLYIYYATGLFT
PAVWYVLLNLPIFVVGWLCVSRRFFFYSLYGTAVTTLAAQFITFQSSIHDPLLAAVAAGT
VCGAGLGIVLRSLGSEGGLTIISIVLHQRWNIRVGQFSFAYNFLLFMIGLATMETDVVLY
SVIMVYTYSTVMDYVHSLFNQRKLVFIISDCVDCIAHDVLEHLHRGVTLLEGQGAFTGRS
KRVALIVVPNIQLKRLEELVFNADPNAFMIIENTFNVLGSGFSRRKVY