Protein Info for DVU2763 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: TPR/GGDEF domain protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 792 transmembrane" amino acids 60 to 79 (20 residues), see Phobius details amino acids 87 to 105 (19 residues), see Phobius details PF00990: GGDEF" amino acids 110 to 260 (151 residues), 40 bits, see alignment E=2.5e-13 PF13432: TPR_16" amino acids 571 to 626 (56 residues), 25.1 bits, see alignment 1.4e-08 amino acids 637 to 691 (55 residues), 26.6 bits, see alignment 4.9e-09 PF07719: TPR_2" amino acids 594 to 625 (32 residues), 24.9 bits, see alignment (E = 1e-08) amino acids 627 to 659 (33 residues), 25.3 bits, see alignment (E = 8e-09) PF13424: TPR_12" amino acids 594 to 655 (62 residues), 36.1 bits, see alignment 4.2e-12 PF13181: TPR_8" amino acids 594 to 624 (31 residues), 14.2 bits, see alignment (E = 2.8e-05) amino acids 628 to 658 (31 residues), 22.4 bits, see alignment (E = 6.8e-08) amino acids 662 to 687 (26 residues), 13.4 bits, see alignment (E = 5.3e-05) PF14559: TPR_19" amino acids 605 to 658 (54 residues), 28.8 bits, see alignment 8.8e-10 amino acids 673 to 737 (65 residues), 34 bits, see alignment E=2.2e-11 PF13431: TPR_17" amino acids 614 to 646 (33 residues), 22.1 bits, see alignment (E = 8.9e-08) PF13174: TPR_6" amino acids 628 to 658 (31 residues), 17.1 bits, see alignment (E = 4.7e-06) PF07721: TPR_4" amino acids 696 to 718 (23 residues), 18.8 bits, see alignment (E = 1.3e-06) PF13428: TPR_14" amino acids 697 to 737 (41 residues), 25.3 bits, see alignment 1.2e-08 PF13176: TPR_7" amino acids 698 to 728 (31 residues), 15.6 bits, see alignment (E = 1e-05)

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvl:Dvul_0546)

Predicted SEED Role

"TPR repeat"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q727U1 at UniProt or InterPro

Protein Sequence (792 amino acids)

>DVU2763 TPR/GGDEF domain protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MTAPALLSREAELSRRDLIALESRLREAVSRFLPFKAYSLYFPREAETVEPLWLPGEGRL
LLPLIHGGALLAVFVARGVPRRIVRSLMPAFPGLLALCMENLALYKAGRTDALTGLSTRQ
HLVERMAREADHVRTCFANPPEGEGDLGAPLHRACMGLVVVRLASLRQVARDHGYTFADR
LTTELARELSALAPEQALAARTGDYEFALLVPAAASGVCRKLAEEAVQRLSAVSLRCGLT
EKAVRVCVSAGYAVYPRDMEGALFERDMAEQARVLLRKARLAAAVAGEGEGSEGPGVMGF
ARILAEGGAVVETHPLSRVMVNLGRSMNAREGQRFSVWSVAYPVRGGTHEPRQPLYKGEV
VLLEVREDRSVAEILHLGDPTWPIEPGDRLTLLPEEKGGDARRDASGVQVDPLTGLYRHG
DFLARWSEAREGCDCFALALVRFSDDGRDPEGRASHPEQLMAEAAQLCRDHFGAETLGGR
YGLNSIVFFHPDMTCDAARESYRQLCDLLSKRLRIDAAVGVGCHPFLAYRRADALENALK
ALEYALLLPEPRVGIFDSLALNISADKRFSLGDTFGAIEEYKTALLADEGNTMAWNSLGV
CMAGLGRHGEARRYFEQALQRKPGDPMALYNLGTVCQSLGETAEARKQYRKCLKYAPGHV
FALVRLGQLAEGEKRYAQARQYFNKAARAGDSGGLVHRNLARLSMRQGRPDEAREHLHDA
LLRNPQDAVALQLMARLYLDGGEDPAMAEALSRQSVALRPDLKQGWLELARALDARGHVA
EAREARLRAGER