Protein Info for DVU2762 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: membrane protein, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 40 to 57 (18 residues), see Phobius details amino acids 67 to 83 (17 residues), see Phobius details amino acids 90 to 90 (1 residues), see Phobius details amino acids 93 to 116 (24 residues), see Phobius details amino acids 123 to 142 (20 residues), see Phobius details amino acids 154 to 172 (19 residues), see Phobius details amino acids 184 to 204 (21 residues), see Phobius details amino acids 216 to 236 (21 residues), see Phobius details amino acids 245 to 266 (22 residues), see Phobius details amino acids 273 to 291 (19 residues), see Phobius details PF00892: EamA" amino acids 11 to 140 (130 residues), 48.6 bits, see alignment E=4.9e-17 amino acids 154 to 288 (135 residues), 37.1 bits, see alignment E=1.7e-13

Best Hits

KEGG orthology group: None (inferred from 99% identity to dvl:Dvul_0547)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q727U2 at UniProt or InterPro

Protein Sequence (306 amino acids)

>DVU2762 membrane protein, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MEDSTCLSRGGLLRVFAGAVIISFSPVFVKMVDVGPSQTAFYRLFFGGVALLAVALWRGQ
RFAAPKGVYAVTLGAALFFGFDLECWHRSILLVGPGLATILGNFQVFLVALAGALLLRER
IPVRLLVAMPLAVAGLWLLLGVTPDSLSGDMLPGVGYGFATAFWYALYILLLRRSQGMAG
QLPAEANMALVSLACAALIGLGVLGRGGDFSIPDAGSLAVLLVYGVFCQGLGWLLLSSGL
PRLPASLGGLVMLAQPALAFVWDIVFFDRPTGPLGLVGASLALFAIWLGLSSGGRRERVC
RAGEDD