Protein Info for DVU2756 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: radical SAM domain protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 TIGR03700: putative menaquinone biosynthesis radical SAM enzyme, SCO4494 family" amino acids 15 to 367 (353 residues), 550.6 bits, see alignment E=1.3e-169 TIGR00423: radical SAM domain protein, CofH subfamily" amino acids 59 to 365 (307 residues), 374.8 bits, see alignment E=3.4e-116 PF04055: Radical_SAM" amino acids 66 to 237 (172 residues), 63.5 bits, see alignment E=2.8e-21 PF19288: CofH_C" amino acids 249 to 368 (120 residues), 77.6 bits, see alignment E=7.7e-26

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvl:Dvul_0551)

Predicted SEED Role

"Gene SCO4494, often clustered with other genes in menaquinone via futalosine pathway" in subsystem Menaquinone Biosynthesis via Futalosine

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q727U8 at UniProt or InterPro

Protein Sequence (372 amino acids)

>DVU2756 radical SAM domain protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MLDTDHYARLGLGEIRDKVMAGHRLSYDDGLRLFACPDITAIGALAHHVRTRLHGDRTYY
VVNRQVNYTNICVNGCLFCAFQRERGQQGAFALTPDEMVARVMDDGGVPFSEVHIVGGCH
PDLPLEWFEDVIRRIHAARPSIVVKAFTAVEIAHFAKLAGIDTEEVLRRLKAAGLSQLPG
GGAEIFAPDVRQRICPRKIDAEAWLRVAGEAHRLGIGTNCTMLFGHLESEADRVDHLCRL
RAQQDETGGFTCFIPLPFLTENSLLKLPPERVGQHVGLDRLRTVAVSRLMLDNIAHIKAY
WVMMGVKLAQVALHYGANDLDGTIVEEKIGHMAGSDAVQAMTIAQLEDMIRRSGFTPVRR
DTHFNPVEEARA