Protein Info for DVU2749 in Desulfovibrio vulgaris Hildenborough JW710

Name: cobL
Annotation: precorrin-6Y C5,15-methyltransferase (decarboxylating) (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 486 PF00590: TP_methylase" amino acids 78 to 258 (181 residues), 77 bits, see alignment E=4.1e-25 TIGR02467: precorrin-6y C5,15-methyltransferase (decarboxylating), CbiE subunit" amino acids 80 to 270 (191 residues), 156.8 bits, see alignment E=5.2e-50 TIGR02469: precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit" amino acids 304 to 429 (126 residues), 100.4 bits, see alignment E=8.7e-33 PF01135: PCMT" amino acids 310 to 426 (117 residues), 26.2 bits, see alignment E=1.3e-09 PF00891: Methyltransf_2" amino acids 311 to 432 (122 residues), 23.3 bits, see alignment E=7.5e-09

Best Hits

KEGG orthology group: K00595, precorrin-6Y C5,15-methyltransferase / precorrin-8W decarboxylase [EC: 1.-.-.- 2.1.1.132] (inferred from 100% identity to dvu:DVU2749)

Predicted SEED Role

"Cobalt-precorrin-6y C5-methyltransferase (EC 2.1.1.-) / Cobalt-precorrin-6y C15-methyltransferase [decarboxylating] (EC 2.1.1.-)" in subsystem Coenzyme B12 biosynthesis (EC 2.1.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-, 2.1.1.-

Use Curated BLAST to search for 1.-.-.- or 2.1.1.- or 2.1.1.132

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q727V5 at UniProt or InterPro

Protein Sequence (486 amino acids)

>DVU2749 precorrin-6Y C5,15-methyltransferase (decarboxylating) (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MEDASPATAAADIGAAHVAVPECGAAPDALAGRDGAEAVSLDAGLSGGSASDGHAKVSES
AFCASPEVGDAGCCLPPLTVLGLGTGDTALSPVHESLLRDAEVLVGGRRQLAAFRGHPAR
QVVIASPVTDALEAVARLREEGRRVVVLADGDPLFFGIGTRVARDFGPDAVRVVPSVSCL
QAAAARLGMAWHDTVTVSMHGRDDWRPLAAAVLGGHPVCVLTDGVNTPDRIARHLLDRGV
DWFRAHVFEDMGTVEEQAHDLSLAACAALDFGPCCTVLLVPQGEVRGPRTGMPDTFFAAE
AGLLTKWPVRAVALAALRVNPADTVWDVGAGSGAMSVECAAVASRGSVWAVERDAARVVC
VEENRRRMGAANIEVVHGDAPACLASLPTPDRVFMGGGLGGISADASCPVLHTVCERLAP
GGRVVVACVLLGSLERALGVFRNLGWPAEVVCVQASVSSPLAGDMRLAAFNPVHLVSAAR
PQTGGQ