Protein Info for DVU2724 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: phage baseplate assembly protein V, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 208 TIGR01644: phage baseplate assembly protein V" amino acids 16 to 205 (190 residues), 100.2 bits, see alignment E=5.3e-33 PF06890: Phage_Mu_Gp45" amino acids 21 to 87 (67 residues), 81.5 bits, see alignment E=3.5e-27 PF18946: Apex" amino acids 188 to 205 (18 residues), 21.4 bits, see alignment (E = 2.2e-08)

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU2724)

Predicted SEED Role

"Prophage baseplate assembly protein V"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q727Y0 at UniProt or InterPro

Protein Sequence (208 amino acids)

>DVU2724 phage baseplate assembly protein V, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MMQQVNRAIARTLATIRQAFRARLTGLDTTPGVQLAQAGGLAGEQVQASELFQHFGFTSA
PPEGTQCIVLPLGGKTAHSVVVATENGAYRVQALQGGEVCIYNQWGAKITLKKEKIVEVD
CDHFRVAAKESITMDTKRWQATATEGTAFTSPSVAIGGMGGLKAQARLDADLQTTGDVTS
QGDHVAGGISLRHHRHPGDSGGTTGESL