Protein Info for DVU2668 in Desulfovibrio vulgaris Hildenborough JW710

Name: glmU
Annotation: UDP-N-acetylglucosamine pyrophosphorylase, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 455 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details PF12804: NTP_transf_3" amino acids 7 to 130 (124 residues), 73.1 bits, see alignment E=7.9e-24 PF00483: NTP_transferase" amino acids 7 to 214 (208 residues), 38.6 bits, see alignment E=2.4e-13 TIGR01173: UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase" amino acids 7 to 449 (443 residues), 511 bits, see alignment E=1.5e-157 PF14602: Hexapep_2" amino acids 398 to 432 (35 residues), 32.6 bits, see alignment 1.4e-11 PF00132: Hexapep" amino acids 398 to 432 (35 residues), 34.5 bits, see alignment 2.7e-12

Best Hits

Swiss-Prot: 100% identical to GLMU_DESVH: Bifunctional protein GlmU (glmU) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K04042, bifunctional UDP-N-acetylglucosamine pyrophosphorylase / Glucosamine-1-phosphate N-acetyltransferase [EC: 2.3.1.157 2.7.7.23] (inferred from 100% identity to dvl:Dvul_0588)

Predicted SEED Role

"N-acetylglucosamine-1-phosphate uridyltransferase (EC 2.7.7.23) / Glucosamine-1-phosphate N-acetyltransferase (EC 2.3.1.157)" in subsystem Peptidoglycan Biosynthesis or Sialic Acid Metabolism or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 2.3.1.157, EC 2.7.7.23)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.157 or 2.7.7.23

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q728D5 at UniProt or InterPro

Protein Sequence (455 amino acids)

>DVU2668 UDP-N-acetylglucosamine pyrophosphorylase, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MASTTGALILAAGKGTRMHSDKPKVLQTILGEPMLRFVMDALAPVFGDRVWTVVGHRADM
IYAAFAGEDARFVVQEQQLGTGHALQMAWESLRAAGLDRVVVVNGDTPLLATETIDFFLK
ESAEADIAFMTLTLPDPGAYGRVVRHNGHVAAIVEAKDYDEALYGPEPSEINTGIYALRL
DAVESLLPRLTNANRSGEYYITDLVGLAVAERMNVLGIQCGEDPNLLGVNNPAELIRSEA
LLRTRLVIGHIEGGVLIHAPETVRISPRATIEPGAEIYGPCEIYGTSRIARGAVVHSHCW
LRNAEVESGSEVKSFSHLEGATVGKGCSVGPFARLRPGAVLDEEARVGNFVEMKKARLHK
GAKAGHLTYLGDADVGAGANIGAGTITCNYDGKNKHRTVIGAGAFIGSNTALVAPVTVGD
GSLVGAGSVITKDVPEASLAIARGRQTNLPRKPKA