Protein Info for DVU2667 in Desulfovibrio vulgaris Hildenborough JW710

Name: pstS
Annotation: phosphate ABC transporter, periplasmic phosphate-binding protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 292 signal peptide" amino acids 1 to 39 (39 residues), see Phobius details TIGR02136: phosphate binding protein" amino acids 25 to 290 (266 residues), 208.4 bits, see alignment E=7e-66 PF12849: PBP_like_2" amino acids 50 to 277 (228 residues), 136.6 bits, see alignment E=2e-43 PF13531: SBP_bac_11" amino acids 53 to 287 (235 residues), 33.5 bits, see alignment E=5.7e-12 PF12727: PBP_like" amino acids 69 to 226 (158 residues), 42.6 bits, see alignment E=5.9e-15

Best Hits

KEGG orthology group: K02040, phosphate transport system substrate-binding protein (inferred from 100% identity to dvl:Dvul_0589)

Predicted SEED Role

"Phosphate ABC transporter, periplasmic phosphate-binding protein PstS (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q728D6 at UniProt or InterPro

Protein Sequence (292 amino acids)

>DVU2667 phosphate ABC transporter, periplasmic phosphate-binding protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSRVISTRLSTYRDRLVRAAGHAFVVCAFVVLAQVAHAASPLEAFKGMSGNLDIAGGTAH
IPVMKEAAKRIMTQNAAIRISVAGGGSGVGVQQVGEGLVAIGNTGRALSEAEVAKYGLVS
FPFAIDGVAVVVNPANPVGALTAAQVRDIYAGKVTNWKALGGADRAITLYTRDEASGTRE
VFDGKLLAKGAVAASANVVPSNGAMKTAVAQDAGAIGYVGIGHIDTSVKAPVLDGMVATQ
ENAANGSYTVTRKLYMNTKGQPTGLVRAFIDYLFTDEGADIIRASGYIPTGR