Protein Info for DVU2666 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: phosphate ABC transporter, permease protein, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 signal peptide" amino acids 9 to 12 (4 residues), see Phobius details transmembrane" amino acids 13 to 38 (26 residues), see Phobius details amino acids 71 to 95 (25 residues), see Phobius details amino acids 107 to 131 (25 residues), see Phobius details amino acids 143 to 166 (24 residues), see Phobius details amino acids 187 to 210 (24 residues), see Phobius details amino acids 257 to 280 (24 residues), see Phobius details PF00528: BPD_transp_1" amino acids 100 to 282 (183 residues), 34.7 bits, see alignment E=7.8e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU2666)

Predicted SEED Role

"Phosphate transport system permease protein PstC (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q728D7 at UniProt or InterPro

Protein Sequence (291 amino acids)

>DVU2666 phosphate ABC transporter, permease protein, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MMLRRWKGGVVTTVCALCAASVALALVAIFAFLCLFALPVFMDGQGFAVIAGDWKPATGS
YGVLPMLQASMGVAGIALVIGFPLSLGICCGMNGLAPSGVGQMFRGLVRCLTAVPTVVYG
FAALFLLVPLVREAAGRGTGLCWLTASLVLALLVVPTMVLVMEAGMGPTVERVRLTGAAM
GLNRGQVMVHMVLPLCWRHMAGAAALGFGRAMGDTLLPLMLAGNAVQSPGSPLESVRTLT
AHIALVLATDSRSGTYGSLFVAGCLLLLLNLAVQLVLRVLARSGAQFRGRT