Protein Info for DVU2643 in Desulfovibrio vulgaris Hildenborough JW710

Name: htpG
Annotation: heat shock protein HtpG (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 637 PF13589: HATPase_c_3" amino acids 32 to 149 (118 residues), 34 bits, see alignment E=2.8e-12 PF00183: HSP90" amino acids 217 to 627 (411 residues), 352.8 bits, see alignment E=4.2e-109

Best Hits

Swiss-Prot: 100% identical to HTPG_DESVH: Chaperone protein HtpG (htpG) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K04079, molecular chaperone HtpG (inferred from 100% identity to dvl:Dvul_0607)

Predicted SEED Role

"Chaperone protein HtpG" in subsystem Protein chaperones

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q728G0 at UniProt or InterPro

Protein Sequence (637 amino acids)

>DVU2643 heat shock protein HtpG (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MATAPASHAFRTEVRKMLHIITHSLYTNREIFLRELVSNASDALDKLRFIRSRGDAVVAP
DLAPGIDISVDKEARILTIADTGVGMTRQELMDNLGTIARSGSEQFVADLAAAENAKDAD
AASIIGRFGVGFYAVFMVADRVEVTSRSYIEGEAAHTWTSDGLGEFTVEEATGDIPQRGT
VIKAHLREDAAEFLEKYRIEGILRKHSQFISFPIRVDGEQVNTTPALWREPKFSITDEQY
ADFYKHLTFDTEAPLRTLHVSVDAPVQFTGLVFVPPHGQEVFSMGRDRWGLDLYVRRVLI
QRENKDLLPEYLGFLKGIVDTEDLPLNISRETLQENVVVRKIGQTLTKQVLADLARLAAD
DAEAYATFWRQHGKVFKLGYSDYANREKFAPLLRFNSSHHDDAQGLTSLDDYISRAREGQ
KEIWYIAAPGREAARLDPRVEVFRRKGLEVLYLLEPIDEFVLETLDSYSDFSFKAVEHAD
GEKLAQFEDTGPARDVTPLTEDEDAAFARLIERMKALLGDAVEDVRISHRLADSPACLVQ
PGGASTSSMDRLLRVLHKDESVPRKVFEVNRDHPILRNLLKVFTSDASDPLVEDTTRQLF
ATSLMLDGYLKDPHELAAMMHRLMEKSGDWYKAVRGL