Protein Info for DVU2608 in Desulfovibrio vulgaris Hildenborough JW710

Name: motA-3
Annotation: chemotaxis protein MotA (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 281 signal peptide" amino acids 5 to 6 (2 residues), see Phobius details transmembrane" amino acids 7 to 21 (15 residues), see Phobius details amino acids 26 to 29 (4 residues), see Phobius details amino acids 32 to 52 (21 residues), see Phobius details amino acids 171 to 190 (20 residues), see Phobius details amino acids 196 to 219 (24 residues), see Phobius details TIGR03818: flagellar motor stator protein MotA" amino acids 1 to 280 (280 residues), 359.1 bits, see alignment E=7.3e-112 PF20560: MotA_N" amino acids 4 to 93 (90 residues), 93.3 bits, see alignment E=8.8e-31 PF01618: MotA_ExbB" amino acids 135 to 235 (101 residues), 40 bits, see alignment E=3e-14

Best Hits

KEGG orthology group: K02556, chemotaxis protein MotA (inferred from 100% identity to dvu:DVU2608)

Predicted SEED Role

"Flagellar motor rotation protein MotA" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q728J5 at UniProt or InterPro

Protein Sequence (281 amino acids)

>DVU2608 chemotaxis protein MotA (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MFIIIGLVVVFGSIIGGYLIANGNLAVLVQPAEMIIILGAAMGAFLASQTKYTLGLVIKN
IKHIFGDPGMNKARYLETLALLNSLFSKMHREGVISIEQDIEKPESSAIFTKYPSISKDK
HIVHFIGDTLRVYLTTGDPSDIESLMKIDMESMHEEEMVAPGAVNRMAESLPGMGIVAAV
LGVVLTMGMINEPPEILGHHIGAALVGTFVGILFCYGIFGPMAAKLENHAHEMHAYYNVI
KEGVAAAIRGSTPIIAVEYGRRAIPHAFRPTFAEMEEKLKG