Protein Info for DVU2586 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: ABC transporter, ATP-binding protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 560 TIGR03719: ATP-binding cassette protein, ChvD family" amino acids 7 to 558 (552 residues), 942.7 bits, see alignment E=6.6e-288 PF00005: ABC_tran" amino acids 25 to 196 (172 residues), 79.2 bits, see alignment E=7.1e-26 amino acids 346 to 478 (133 residues), 89 bits, see alignment E=6.6e-29 PF12848: ABC_tran_Xtn" amino acids 235 to 308 (74 residues), 48.2 bits, see alignment E=1.4e-16

Best Hits

Swiss-Prot: 58% identical to ETTA_ECOLI: Energy-dependent translational throttle protein EttA (ettA) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to dvu:DVU2586)

Predicted SEED Role

"ABC transporter, ATP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q728L7 at UniProt or InterPro

Protein Sequence (560 amino acids)

>DVU2586 ABC transporter, ATP-binding protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSNEPDKIIYSMIRVTKRHGQREVLKDISLSYFYGAKIGVLGLNGSGKSSLLKILAGVDQ
NFDGKTVLAPGFTIGYLEQEPLVDETRTVREVVEEGVQDIVDLVKEFEEINARFADPMEP
DEMDALIERQGKVQEQMDAKGAWDLDARLEMAMDALRCPAGDTPVSVISGGERRRVALCR
LLLQNPDILLLDEPTNHLDAESVAWLERFLQGFPGTVIAVTHDRYFLDNVAGWILELDRG
RGIPWKGNYSSWLEQKEKRLANEDKAEAERQKTLKRELEWIRMSPKGRHAKGKARINAYE
AMLSHESEKRAPDLEIYIPPGPRLGKKVIEAQGVSKSMGDKMLIEGLECIIPAGAIVGIV
GPNGAGKTTLFKIIAGLEQPDAGTLTVGDTVKLAYVDQNRESLTPGKTVYELISDGYDTV
KLGTREVNARAYCSRFNFMGQDQQKKVDVLSGGERNRLHVARMLKEGANVILLDEPTNDL
DVNTMRALEDGIENFAGVVLVISHDRWFLDRLATHILAFEGDSKVVFFEGNYSEYDADRK
ARLGKDADTPHRIKFRKLTR