Protein Info for DVU2577 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: DNA-binding response regulator, LuxR family (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 216 PF00072: Response_reg" amino acids 5 to 116 (112 residues), 93.4 bits, see alignment E=1.1e-30 PF00196: GerE" amino acids 152 to 207 (56 residues), 67.3 bits, see alignment E=7.3e-23

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvl:Dvul_0670)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q728M6 at UniProt or InterPro

Protein Sequence (216 amino acids)

>DVU2577 DNA-binding response regulator, LuxR family (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MPITVVIVEDLDIVREGIKALLDANGEFIIVGEASDGIEALRIVEKHAPDIVLMDLTLPV
MEGAEAIREIKRRRETTKVLALTAHKKDSLIYKTLSAGADGYLLKNASRDILFQAMQTVL
AGRRYISPEISDLLIDDFLRHGRRDEASMLDLLSDREKQVLKLVAEGHGNKAVAEKLCIS
HKTVEKHKANLKRKLGTASTAELVTFAIEHGLTVPA