Protein Info for DVU2545 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: alcohol dehydrogenase, iron-containing (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00465: Fe-ADH
  • amino acids 14 to 378 (365 residues), 383.4 bits, E=1e-118
• PF13685: Fe-ADH_2
  • amino acids 16 to 111 (96 residues), 37.9 bits, E=1.8e-13

Best Hits

Swiss-Prot: 40% identical to MEDH_BACMT: NAD-dependent methanol dehydrogenase (mdh) from Bacillus methanolicus

KEGG orthology group: None (inferred from 100% identity to dvu:DVU2545)

MetaCyc: 40% identical to L-lactaldehyde reductase (Salmonella enterica enterica serovar Typhimurium str. LT2)
Lactaldehyde reductase. [EC: 1.1.1.77]

Predicted SEED Role

"alcohol dehydrogenase, iron-containing"

MetaCyc Pathways

• L-lactaldehyde degradation (anaerobic) (1/1 steps found)
• methylglyoxal degradation VI (1/4 steps found)
• nucleoside and nucleotide degradation (halobacteria) (2/6 steps found)
• superpathway of glycol metabolism and degradation (2/7 steps found)
• superpathway of fucose and rhamnose degradation (4/12 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism
• Pyruvate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.77

Sequence Analysis Tools

See Q728Q8 at UniProt or InterPro

Protein Sequence (386 amino acids)

>DVU2545 alcohol dehydrogenase, iron-containing (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MESARELRKFVAPEFVFGNGAARLAGRYVHNLGGTRCLVVTDPGVMRNGHADTVIGSLTA
YGIAHAVFQDISPNPRDVEVQRGVEAYHREGCDAIVAVGGGSPIDCAKGIGIVASNGGSI
SLYEGVDAIPKPMPPLVCVPTTAGSAADVSQFAIITDTTRMVKIAIVSKAAVADVSLIDP
STTKSMSRDLTAATGIDTLTHAIEAFASNASGPITDMFALEAISLVNTHLPQVLADGDDD
TAREGMALACLNAGLAFSNAILGAVHAMAHSLGGLLDLPHGECNAILLPFVVRRNFDAAP
VRYARVANALGIDVGGTPATAIRDALFDRLMTLRTAAGFTRGLSAFGVTREQIGRLARLA
VEDPCLATNPEALDIADIESLYAEAL