Protein Info for DVU2534 in Desulfovibrio vulgaris Hildenborough JW710

Name: pheS
Annotation: phenylalanyl-tRNA synthetase, alpha subunit (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 PF02912: Phe_tRNA-synt_N" amino acids 23 to 90 (68 residues), 74.8 bits, see alignment E=4.2e-25 TIGR00468: phenylalanine--tRNA ligase, alpha subunit" amino acids 43 to 344 (302 residues), 318 bits, see alignment E=3.5e-99 PF01409: tRNA-synt_2d" amino acids 93 to 344 (252 residues), 329.7 bits, see alignment E=1.1e-102

Best Hits

Swiss-Prot: 100% identical to SYFA_DESVV: Phenylalanine--tRNA ligase alpha subunit (pheS) from Desulfovibrio vulgaris subsp. vulgaris (strain DP4)

KEGG orthology group: K01889, phenylalanyl-tRNA synthetase alpha chain [EC: 6.1.1.20] (inferred from 100% identity to dvl:Dvul_0711)

Predicted SEED Role

"Phenylalanyl-tRNA synthetase alpha chain (EC 6.1.1.20)" (EC 6.1.1.20)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.1.1.20

Use Curated BLAST to search for 6.1.1.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q728R9 at UniProt or InterPro

Protein Sequence (345 amino acids)

>DVU2534 phenylalanyl-tRNA synthetase, alpha subunit (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MDLLKELESLVPELERGLGQASSLQELEEQRIAFLGRKGRLAQVMAHLPELAPAERPRVG
QAANTVKQALTELFEQRKVVLEQAKEAAALSRFDPSLPGRMPWRGSLHPVTLVMEEICSV
FGALGYDIVTGPEVENDYHNFEALNMPPEHPARDMQDTLYITESILMRTHTSPLQVRTMK
SLRPPVAAIAPGKVYRRDSDITHTPMFHQIEGFMVDHNVSMAELRGTLTSFLRTVFGGDT
RVRFRPSFFPFTEPSAEVDISCCICGGKGHVGNEPCRVCKTTGWVEILGCGMIDPEVFKS
VGYDPEVYTGFAFGLGVERVAMLKYGIGDLRMFFENDVRFLSQFA