Protein Info for DVU2531 in Desulfovibrio vulgaris Hildenborough JW710

Name: rpe
Annotation: ribulose-phosphate 3-epimerase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 222 PF00834: Ribul_P_3_epim" amino acids 3 to 199 (197 residues), 265.4 bits, see alignment E=1.3e-83 TIGR01163: ribulose-phosphate 3-epimerase" amino acids 3 to 209 (207 residues), 283 bits, see alignment E=6e-89

Best Hits

Swiss-Prot: 55% identical to RPE_SYNY3: Ribulose-phosphate 3-epimerase (rpe) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K01783, ribulose-phosphate 3-epimerase [EC: 5.1.3.1] (inferred from 99% identity to dvl:Dvul_0714)

Predicted SEED Role

"Ribulose-phosphate 3-epimerase (EC 5.1.3.1)" in subsystem Calvin-Benson cycle or Conserved gene cluster associated with Met-tRNA formyltransferase or Pentose phosphate pathway or Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization (EC 5.1.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q728S2 at UniProt or InterPro

Protein Sequence (222 amino acids)

>DVU2531 ribulose-phosphate 3-epimerase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MILSPSLLSSDFGRLTEELAALEAAGVKWVHWDVMDGRFVPNITYGQPVISHLRKKSGLF
FDVHLMVHEPERYLADFAKAGADMLVVHAEATNHLQRTLAEIRRLGCKAGVALNPHTPLS
VLDYVLEDVDMVLIMSVNPGFGGQKFLPATYRKIRDLRAMLDARGLSAHIQVDGGVDPSN
TAALVESGADVLVSGSAFFGFPPYDQRLRAFEDAAAAARPAN