Protein Info for DVU2503 in Desulfovibrio vulgaris Hildenborough JW710

Name: murC
Annotation: UDP-N-acetylmuramate--alanine ligase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01225: Mur_ligase
  • amino acids 7 to 104 (98 residues), 105.1 bits, E=3.1e-34
• TIGR01082: UDP-N-acetylmuramate--L-alanine ligase
  • amino acids 8 to 449 (442 residues), 531 bits, E=1.5e-163
• PF08245: Mur_ligase_M
  • amino acids 110 to 288 (179 residues), 90.4 bits, E=2.3e-29
• PF02875: Mur_ligase_C
  • amino acids 308 to 392 (85 residues), 69 bits, E=5.2e-23

Best Hits

Swiss-Prot: 100% identical to MURC_DESVV: UDP-N-acetylmuramate--L-alanine ligase (murC) from Desulfovibrio vulgaris subsp. vulgaris (strain DP4)

KEGG orthology group: K01924, UDP-N-acetylmuramate--alanine ligase [EC: 6.3.2.8] (inferred from 100% identity to dvl:Dvul_0742)

Predicted SEED Role

"UDP-N-acetylmuramate--alanine ligase (EC 6.3.2.8)" in subsystem Peptidoglycan Biosynthesis (EC 6.3.2.8)

MetaCyc Pathways

• peptidoglycan biosynthesis I (meso-diaminopimelate containing) (11/12 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis I (meso-diaminopimelate containing) (8/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis II (lysine-containing) (7/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis III (meso-diaminopimelate containing) (6/8 steps found)
• peptidoglycan biosynthesis III (mycobacteria) (11/15 steps found)
• peptidoglycan biosynthesis II (staphylococci) (12/17 steps found)
• peptidoglycan biosynthesis IV (Enterococcus faecium) (12/17 steps found)
• peptidoglycan biosynthesis V (β-lactam resistance) (11/17 steps found)

KEGG Metabolic Maps

• D-Glutamine and D-glutamate metabolism
• Peptidoglycan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.8

Sequence Analysis Tools

See P61678 at UniProt or InterPro

Protein Sequence (454 amino acids)

>DVU2503 UDP-N-acetylmuramate--alanine ligase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MKNKVRTIHMVGIGGSGMSGIAEVLLNLGYAVHGSDMSDSAVVRRLRKIGAEIFIGHGAG
NVSDAEVLVKSTAVRDDNPEVLAAVEKGIPIIPRAEMLAELMRLRTGIAIAGTHGKTTTT
SLTAAIFDVAGKDPTVIIGGRLNAYGANARLGEGEYLIAEADESDGSFLCLFPIVNVVTN
VDMDHVDFYAGQKEIDEAFVTFMNKVPFYGANVVCGDDPGVRRLLPQVKRRVVTYGFGKD
NALRAEVTSCAETSVFTVFLRGGRLGEVHLGQPGRHNILNALAAIGVALEAGISPEHCIE
GLARFGGVGRRFERRGERDGVTVVDDYGHHPVEIAATLATARSVYPDRRLVVVFQPHRFS
RTQALFGEFCKVFEPVDKLLLTEIYPASEKPIPGVSGQSLAQGIRQVSNTDVTYYQSFDE
ILAALPGVLRPGDVLLTLGAGSVTTIGQRYVAGE