Protein Info for DVU2502 in Desulfovibrio vulgaris Hildenborough JW710

Name: murB
Annotation: UDP-N-acetylenolpyruvoylglucosamine reductase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 TIGR00179: UDP-N-acetylenolpyruvoylglucosamine reductase" amino acids 10 to 294 (285 residues), 169.1 bits, see alignment E=6.7e-54 PF01565: FAD_binding_4" amino acids 49 to 150 (102 residues), 47.4 bits, see alignment E=1.7e-16 PF02873: MurB_C" amino acids 194 to 293 (100 residues), 96.5 bits, see alignment E=9e-32

Best Hits

Swiss-Prot: 100% identical to MURB_DESVH: UDP-N-acetylenolpyruvoylglucosamine reductase (murB) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K00075, UDP-N-acetylmuramate dehydrogenase [EC: 1.1.1.158] (inferred from 100% identity to dvu:DVU2502)

Predicted SEED Role

"UDP-N-acetylenolpyruvoylglucosamine reductase (EC 1.1.1.158)" in subsystem Peptidoglycan Biosynthesis or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 1.1.1.158)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.158

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q728V0 at UniProt or InterPro

Protein Sequence (296 amino acids)

>DVU2502 UDP-N-acetylenolpyruvoylglucosamine reductase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MLKVLEGPSLAERTTLRLGGRALAEVRVTSRDALDDLPGVLQCLGGSPLMLGCGSNILAA
DGELPVVVVSLDMDDAPTIVGETAEGVVVRVGAATRLPRLLGQLASWGLAGLEGLAGIPG
SVGGAVAMNAGSYGCEFGTVLRSVEVFSPDFGLADVPHENIEYAYRHFGLKGCHGWFVVT
GADIVLRRGESAAITAAMRANYLKKKSTQPVLARSAGCVFRNPAPGVSAGRLIDQAGLRG
KRIGGMAFSEVHANFLVNEGAGRSDEAFELLQLAQEIVKRRHGMDLTLEVKILSWL