Protein Info for DVU2501 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: cell division protein FtsQ, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 transmembrane" amino acids 37 to 62 (26 residues), see Phobius details PF08478: POTRA_1" amino acids 71 to 139 (69 residues), 70.4 bits, see alignment E=1.3e-23

Best Hits

KEGG orthology group: K03589, cell division protein FtsQ (inferred from 100% identity to dvl:Dvul_0744)

Predicted SEED Role

"Cell division protein FtsQ" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q728V1 at UniProt or InterPro

Protein Sequence (278 amino acids)

>DVU2501 cell division protein FtsQ, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MAVALSRGKKKSRNSYSRSWSKSEKKSSLPTKGIGSFFRWVSGLVIVGSLLVLMSVAVLY
AYRFMTTHEYFAIRDVEISGNLMLSKDEILATAGLVEGANSIALNIADVEDRLASSPWIA
EVSVKRLLPDRFAIRVTEREPAFWVLRDGTLYYADVHGNILAPVGPGRFTSLPTLEVGPG
GEDLLARMPEVIAAFKGARLPVDISLVSWVRLSAGRGVELYLDNPGLRISVAPENLGGNL
DRLCQVLADLGRRGELREVGEVRAADGNVWVLKDPESR