Protein Info for DVU2490 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: Histidinol phosphatase (Natalia Ivanova)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01856: histidinol phosphate phosphatase, HisJ family
  • amino acids 4 to 249 (246 residues), 134.3 bits, E=3.1e-43
• PF02811: PHP
  • amino acids 5 to 203 (199 residues), 73.9 bits, E=9.9e-25

Best Hits

KEGG orthology group: K04486, histidinol-phosphatase (PHP family) [EC: 3.1.3.15] (inferred from 99% identity to dvl:Dvul_0754)

Predicted SEED Role

"Histidinol-phosphatase (EC 3.1.3.15)" in subsystem Histidine Biosynthesis (EC 3.1.3.15)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• L-histidine biosynthesis (10/10 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Histidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.15

Sequence Analysis Tools

See Q728W2 at UniProt or InterPro

Protein Sequence (274 amino acids)

>DVU2490 Histidinol phosphatase (Natalia Ivanova) (Desulfovibrio vulgaris Hildenborough JW710)
MITIDLHTHTSHSHGQATVQEMFEAGCARGLLVHGFSEHSPRPSGYDYPKDYRDKLTRSF
PDYVEQVRTLAATYAPERTVLLGLEMDWLPGQEPFIDATIHRYDYDYVIGGIHFLGTWGF
DYTPDDWQGFSPEQTADIYVRYFESLRRMAASGMFDIAAHPDIIKIFSAAAFHDWLATDK
AKAVVRDALETMHTAGMAMEISSAGLRKPCKEIYPCPDIMRMAADIGLPVTFGSDAHCVN
TIGWGFDTLADYARGFGYTRSVWMRRGERFERPF