Protein Info for DVU2490 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: Histidinol phosphatase (Natalia Ivanova)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 TIGR01856: histidinol phosphate phosphatase, HisJ family" amino acids 4 to 249 (246 residues), 134.3 bits, see alignment E=3.1e-43 PF02811: PHP" amino acids 5 to 203 (199 residues), 73.9 bits, see alignment E=9.9e-25

Best Hits

KEGG orthology group: K04486, histidinol-phosphatase (PHP family) [EC: 3.1.3.15] (inferred from 99% identity to dvl:Dvul_0754)

Predicted SEED Role

"Histidinol-phosphatase (EC 3.1.3.15)" in subsystem Histidine Biosynthesis (EC 3.1.3.15)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q728W2 at UniProt or InterPro

Protein Sequence (274 amino acids)

>DVU2490 Histidinol phosphatase (Natalia Ivanova) (Desulfovibrio vulgaris Hildenborough JW710)
MITIDLHTHTSHSHGQATVQEMFEAGCARGLLVHGFSEHSPRPSGYDYPKDYRDKLTRSF
PDYVEQVRTLAATYAPERTVLLGLEMDWLPGQEPFIDATIHRYDYDYVIGGIHFLGTWGF
DYTPDDWQGFSPEQTADIYVRYFESLRRMAASGMFDIAAHPDIIKIFSAAAFHDWLATDK
AKAVVRDALETMHTAGMAMEISSAGLRKPCKEIYPCPDIMRMAADIGLPVTFGSDAHCVN
TIGWGFDTLADYARGFGYTRSVWMRRGERFERPF