Protein Info for DVU2481 in Desulfovibrio vulgaris Hildenborough JW710

Name: fdoH
Annotation: formate dehydrogenase, beta subunit, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 PF13247: Fer4_11" amino acids 89 to 190 (102 residues), 136.2 bits, see alignment E=2e-44

Best Hits

Swiss-Prot: 54% identical to FDHB_DESGG: Formate dehydrogenase subunit beta (fdhB) from Desulfovibrio gigas (strain ATCC 19364 / DSM 1382 / NCIMB 9332 / VKM B-1759)

KEGG orthology group: K00124, formate dehydrogenase, beta subunit [EC: 1.2.1.2] (inferred from 100% identity to dvu:DVU2481)

MetaCyc: 63% identical to formate dehydrogenase 1 beta subunit (Desulfovibrio vulgaris)
1.2.1.2-RXN [EC: 1.17.1.9]

Predicted SEED Role

"HybA, Fe-S-cluster-containing hydrogenase components 1 homolog"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.2

Use Curated BLAST to search for 1.17.1.9 or 1.2.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q728X1 at UniProt or InterPro

Protein Sequence (260 amino acids)

>DVU2481 formate dehydrogenase, beta subunit, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MRPLGSLPQGMRRVSRRHIREAYMNGKTFFIDQTRCTACRGCQAACKQWKKFGSIETRNT
GSYQNPPDLGPSTFKLVRFNEVEVDGKLKWLFFPEQCRHCLEPPCKMVADALIPGAIVQD
AETGAVLYTEKTKGLDYMEVRSACPYDIPRQDPATGLLTKCNMCIDRVQNGMLPACVKTC
PTGTMHFGDRADMLELAQKRLGEVKKRSPAALLADSDLVRVLYLCELAPANYHSHMVAEA
DTSRIGPFSRRALLRLRPFA