Protein Info for DVU2468 in Desulfovibrio vulgaris Hildenborough JW710

Name: lpxK
Annotation: tetraacyldisaccharide 4-kinase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 354 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF02606: LpxK" amino acids 11 to 325 (315 residues), 247.1 bits, see alignment E=1.3e-77 TIGR00682: tetraacyldisaccharide 4'-kinase" amino acids 13 to 322 (310 residues), 170.7 bits, see alignment E=2.2e-54

Best Hits

Swiss-Prot: 100% identical to LPXK_DESVH: Tetraacyldisaccharide 4'-kinase (lpxK) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K00912, tetraacyldisaccharide 4'-kinase [EC: 2.7.1.130] (inferred from 100% identity to dvu:DVU2468)

Predicted SEED Role

"Tetraacyldisaccharide 4'-kinase (EC 2.7.1.130)" in subsystem KDO2-Lipid A biosynthesis or Lipopolysaccharide-related cluster in Alphaproteobacteria (EC 2.7.1.130)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.130

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q728Y4 at UniProt or InterPro

Protein Sequence (354 amino acids)

>DVU2468 tetraacyldisaccharide 4-kinase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MHVAALQNHLAPLLVPCSRVYAACMAVRRRFWESPMSPAFRPSRPVVSVGNIAWGGTGKT
PLVDWLLHWAGTRGLNPAVLTRGYGAKPPTVPFLVGSQHTAEEAGDEPLMLARRNPYAAV
LVDPVRRRAGRWAEHELRPHFYLLDDGMQHLAVRRDLDLVVLRPDDVLDQWGRVLPAGSW
REGASALKSATAFFVKSSPEVFEALAPVLEERLAPYGVPVFSFWLRPSGLLRVGGNEQRP
HFDGAPYVLVSGVGGPGQVGETATRYFGYAPVRHRVFPDHHPYGPDDVRSLAQEGAQLVC
TPKDAVKLERFAGLDLWTFDLQTVFGPAIGTAAPFPQWWDERWARLARERAGTS