Protein Info for DVU2467 in Desulfovibrio vulgaris Hildenborough JW710

Name: rnr
Annotation: ribonuclease R (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 886 TIGR02063: ribonuclease R" amino acids 17 to 712 (696 residues), 663.8 bits, see alignment E=3.2e-203 TIGR00358: VacB and RNase II family 3'-5' exoribonucleases" amino acids 72 to 712 (641 residues), 541.6 bits, see alignment E=2.4e-166 PF08206: OB_RNB" amino acids 81 to 139 (59 residues), 54.6 bits, see alignment 1.4e-18 PF17876: CSD2" amino acids 92 to 141 (50 residues), 29.3 bits, see alignment 1.5e-10 PF00773: RNB" amino acids 257 to 583 (327 residues), 354.5 bits, see alignment E=1.3e-109 PF00575: S1" amino acids 629 to 709 (81 residues), 36.1 bits, see alignment E=1.4e-12

Best Hits

KEGG orthology group: K12573, ribonuclease R [EC: 3.1.-.-] (inferred from 100% identity to dvu:DVU2467)

Predicted SEED Role

"3'-to-5' exoribonuclease RNase R" in subsystem RNA processing and degradation, bacterial

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q728Y5 at UniProt or InterPro

Protein Sequence (886 amino acids)

>DVU2467 ribonuclease R (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MAKDKTSRKAPMGSGRDALMQAFREAQRPLRLDMLLRILGLHRKEKRTLEESLEALQAEG
RILRLRGGAWGLTDHMKMVTGTLQVQRTGMGFVLPEDRRRTDIYVHPTQMGEAWHGDKVV
VVLLPGGRGRNPEGRIVRILERGLKEMPARVVKRMGRQGLLCRAADARIKVHFLVDVTGL
EGKPQKDDILVVSPGERVEDGLWAATAVRHLGSEDDVSVQERLVKINHGVPTEFPVPVLE
EAATLPPAPGGGDFADRIDLRHMEFVTIDGARARDFDDAICVEEQGKGWRLWVAIADVSH
YVRPGSAMDREALERSNSYYFPQSVEPMLPEALSNGLCSLNPRVPRLAMVAEIYFFGEGS
PGKCKFYPAVIESKARLTYGQVNRALLLGDEEERLVLRPVLPMLEQAEKLARVLHQRRRE
RGSLDFDLPEPEIAFNIYGETVDIRRKVRHFGHQIVEEFMIAANEAVARFLTEKEADFLY
RVHPEPEPEKLSALFKVLAGTDIAQGLPREASAGALQTVLQKAHGSAQEFLISRLTLRTM
MQARYSPEHEGHFGLASACYCHFTSPIRRYADLVVHRALKRALGGDPGPTPAGGKLVAIA
DQLSQHERKAMEAEREILKRLTVLLLRSRVGETLTGVISSILDFGFFVELNEVLADGMVR
LSSLDDDYYAFIPERQELRGERTGRTFRLGQQVKVRLADVNVGRLEVNLELVREEGDDTP
VPTRRRSAASGRDGSGRDGSGRGGRGRSRHDATPRVKASPDASPEVSADGDMPDGDRLPP
WIRAATEEDDPRDTTRTRRRRDDDASSRDGGDRRRGRSRNEGARGAGNPARGKAPRDGAG
GDRKKGDGRDGKDGQAGGKPAGKGQSRKGKASSHRKGQGRVKKSDE