Protein Info for DVU2425 in Desulfovibrio vulgaris Hildenborough JW710

Name: rarD
Annotation: rarD protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 transmembrane" amino acids 9 to 27 (19 residues), see Phobius details amino acids 43 to 61 (19 residues), see Phobius details amino acids 73 to 92 (20 residues), see Phobius details amino acids 104 to 121 (18 residues), see Phobius details amino acids 128 to 144 (17 residues), see Phobius details amino acids 150 to 167 (18 residues), see Phobius details amino acids 178 to 195 (18 residues), see Phobius details amino acids 214 to 232 (19 residues), see Phobius details amino acids 244 to 262 (19 residues), see Phobius details amino acids 268 to 285 (18 residues), see Phobius details TIGR00688: protein RarD" amino acids 8 to 260 (253 residues), 226.6 bits, see alignment E=1.9e-71 PF00892: EamA" amino acids 8 to 144 (137 residues), 63 bits, see alignment E=1.9e-21

Best Hits

Swiss-Prot: 42% identical to RARD_SALTI: Protein RarD (rarD) from Salmonella typhi

KEGG orthology group: K05786, chloramphenicol-sensitive protein RarD (inferred from 100% identity to dvl:Dvul_0806)

Predicted SEED Role

"RarD protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q729C6 at UniProt or InterPro

Protein Sequence (295 amino acids)

>DVU2425 rarD protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MTSDTSRKGLVAGLGAFALWGLLPLYWKQLLDVPPFEILCHRILWSFVFLLPVVVFSGRW
AEVRAAVRDRGTLLRVACSGLLVGFNWYLYIWAVNTGHVLETSLGYYINPLMNVALGCVF
LRERPSRLQVAAIALAAFGVLWMLAGYGRFPWVALTLAGSFSLYGFMRKTVKVASVPGLF
IETSILAPFVAVWLVRLHLGGGGAFMHLAPTTDLLLMGAGVATSTPLIWFAFAARSLRLT
TVGVLQYLAPTLAFMLGVFVFHEPLTPSHLVTFGCIWGALALYTIEGWRALHRKP