Protein Info for DVU2404 in Desulfovibrio vulgaris Hildenborough JW710

Name: hdrC
Annotation: heterodisulfide reductase, C subunit (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13183: Fer4_8
  • amino acids 26 to 87 (62 residues), 40.4 bits, E=7.2e-14
• PF13187: Fer4_9
  • amino acids 28 to 86 (59 residues), 33.6 bits, E=6.3e-12
• PF13534: Fer4_17
  • amino acids 29 to 88 (60 residues), 40.6 bits, E=6.1e-14

Best Hits

KEGG orthology group: K03390, heterodisulfide reductase subunit C [EC: 1.8.98.1] (inferred from 100% identity to dvu:DVU2404)

Predicted SEED Role

"CoB--CoM heterodisulfide reductase subunit C (EC 1.8.98.1)" in subsystem Anaerobic respiratory reductases or H2:CoM-S-S-HTP oxidoreductase or Methanogenesis (EC 1.8.98.1)

MetaCyc Pathways

• coenzyme B/coenzyme M regeneration I (methanophenazine-dependent) (1/4 steps found)

KEGG Metabolic Maps

• Folate biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.8.98.1

Use Curated BLAST to search for 1.8.98.1

Sequence Analysis Tools

See Q729E7 at UniProt or InterPro

Protein Sequence (186 amino acids)

>DVU2404 heterodisulfide reductase, C subunit (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MDVTNLETARDESFIHAVMEESGQDLSHCYQCGNCTAGCPCGFAYDIQVSQIMRNLQAGR
KEKVLNSRSIWLCLSCSSCTTRCPNNIDVARVMDVLRHMARREGRGAERCVTTFWDAFLA
SVRKHGRVYELGVVANYVARTGRVLTDIDLLPRIAPKGKLSPLPHGIRGRDEIARIFQRF
EEERTR