Protein Info for DVU2389 in Desulfovibrio vulgaris Hildenborough JW710
Name: tolR
Annotation: biopolymer transport protein, ExbD/TolR family (TIGR)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 38% identical to EXBD_ECOL6: Biopolymer transport protein ExbD (exbD) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
KEGG orthology group: None (inferred from 100% identity to dvu:DVU2389)MetaCyc: 38% identical to Ton complex subunit ExbD (Escherichia coli K-12 substr. MG1655)
Predicted SEED Role
"Biopolymer transport protein ExbD/TolR" in subsystem Ton and Tol transport systems
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q729G2 at UniProt or InterPro
Protein Sequence (137 amino acids)
>DVU2389 biopolymer transport protein, ExbD/TolR family (TIGR) (Desulfovibrio vulgaris Hildenborough JW710) MHLSPDDDGVVSEINVTPFVDVMLVLLVIFMVTAPMMQSGLDVELPKTTTVEAVPEDTPH VVLSIGADGRLMLDETDTTDDALPSLLTERVTTPGRTLFLRADAGVPYGRVVRVLGLVRG AGVSRMHVMAEEEEAGS