Protein Info for DVU2385 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: ABC transporter, permease protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 373 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 146 to 167 (22 residues), see Phobius details amino acids 179 to 204 (26 residues), see Phobius details amino acids 232 to 253 (22 residues), see Phobius details amino acids 289 to 316 (28 residues), see Phobius details amino acids 336 to 361 (26 residues), see Phobius details PF00528: BPD_transp_1" amino acids 159 to 366 (208 residues), 114.3 bits, see alignment E=2.8e-37

Best Hits

KEGG orthology group: K13894, microcin C transport system permease protein (inferred from 100% identity to dvl:Dvul_0844)

Predicted SEED Role

"Oligopeptide transport system permease protein OppB (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q729G6 at UniProt or InterPro

Protein Sequence (373 amino acids)

>DVU2385 ABC transporter, permease protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MRARQSSHGGAWGYMLRRLLLVLPTLLGIVTINFFVVQLAPGGPVEQYIARLEGDGAAYM
ERIGAGDGGDMQPAADDGTAAYKGAAGLSPQAVEAIRRQYGFDRPILERYVTMLGDFALF
RFGDSLFKGRSVIDLVGDAMPVSLSLGLWSTLVIYAVSIPLGMARALRRGSRFDTMSGIA
VIAAHAIPAFLLAVLLIVLFAGGSYLQWFPLRGLVSPGHDALPFGARVLDYAHHMVLPVT
AMVVGGFAGLTSLTRNAFLDELGKAYVETALAKGLTRKAVLWRHVFRNAMLLVISGLPGA
FVRVFFTGSLLIETIFSLNGLGLMGFEAAMQRDYPVMFASLYVFTLIGLTASLAGDMLCM
AVDPRIDFERRAA