Protein Info for DVU2308 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: conserved hypothetical protein TIGR00022 (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 163 PF04074: DUF386" amino acids 1 to 149 (149 residues), 133.5 bits, see alignment E=3e-43 TIGR00022: YhcH/YjgK/YiaL family protein" amino acids 21 to 152 (132 residues), 91.5 bits, see alignment E=2.3e-30

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU2308)

Predicted SEED Role

"probable beta-D-galactosidase" in subsystem Galactosylceramide and Sulfatide metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q729P2 at UniProt or InterPro

Protein Sequence (163 amino acids)

>DVU2308 conserved hypothetical protein TIGR00022 (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MIVASLDHWRRYCAGPLWERAFGFLAHAAADITDGRHVILGDDLYANVATYEPRALDGAR
YEAHECYIDIQYVLAGGEWMHVASRAPLVPAGPYDAAGDVRFYAQGDEAYARVPLLPGTF
AVLYPEDAHMPGLQGPYQGTVRKIVVKVRMAALPPFRHADSSS