Protein Info for DVU2228 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: motB protein, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 244 transmembrane" amino acids 22 to 42 (21 residues), see Phobius details PF13677: MotB_plug" amino acids 15 to 58 (44 residues), 44.2 bits, see alignment 1.2e-15 PF00691: OmpA" amino acids 132 to 232 (101 residues), 52.8 bits, see alignment E=4.3e-18

Best Hits

KEGG orthology group: K02557, chemotaxis protein MotB (inferred from 100% identity to dvl:Dvul_1013)

Predicted SEED Role

"Flagellar motor rotation protein MotB" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q729W9 at UniProt or InterPro

Protein Sequence (244 amino acids)

>DVU2228 motB protein, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MAPGDDEPLFDVEEDEPPNEWMTTLSDISMLLLAFFILLFSLSSIDKKRFAESFETVRMV
FGGKESELTTSNVRTDEGALLETVRLQRELIEAQRQTYNEMRTYFTVNGVEGVIGAVFDE
GVITLRVPSEVLFAPGAVELAPGADRVLATLKDLFIRRREQNINIKGFTDDVQPSANARF
KDNWEVSALRSVNVLRYFLGAGIEPARLTATGLGELDPLFPNTSDENRARNRRVEFVLER
RVVR