Protein Info for DVU2218 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: GTP-binding protein, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 TIGR00157: ribosome small subunit-dependent GTPase A" amino acids 66 to 316 (251 residues), 140.1 bits, see alignment E=4.5e-45 PF03193: RsgA_GTPase" amino acids 86 to 260 (175 residues), 149.6 bits, see alignment E=1.6e-47 PF00005: ABC_tran" amino acids 186 to 234 (49 residues), 26.2 bits, see alignment 2.1e-09 PF01926: MMR_HSR1" amino acids 197 to 261 (65 residues), 23.9 bits, see alignment E=7.6e-09

Best Hits

KEGG orthology group: K06949, ribosome biogenesis GTPase [EC: 3.6.1.-] (inferred from 100% identity to dvu:DVU2218)

Predicted SEED Role

"Probable GTPase related to EngC" in subsystem Universal GTPases

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q729X9 at UniProt or InterPro

Protein Sequence (348 amino acids)

>DVU2218 GTP-binding protein, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MLSDSGYDEWFAGHGERWLADGLSLARIVAVDRGRCMATGNAGEIAAEVSGRFIHEHDDP
ADYPCVGDWVALDIHGGLSAGVIHHVLPRRTWLRRRTAGQTGRHQMIAANVDVAFIVQSC
HYDFCPNRLERYLFMVREGGVKPVVVLTKTDMVSAEALEGLVAVVHSVADVDVIATSAYS
GDGVDAVKAAVEAGKTCCLLGSSGVGKTTLTNLLLGRELFATQHVSATGEGRHQTTRRQM
VILSGGGLLVDTPGMREFGVIGPESEEGFVGEAVERLAGSCRFHDCRHEREPGCAVRAAL
EAGTLSQERYDNYIRLRKEAAFGALSLHERRHRDKNFSKLVKSVKKQR