Protein Info for DVU2217 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: acetyltransferase, GNAT family (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 168 PF13527: Acetyltransf_9" amino acids 13 to 130 (118 residues), 28 bits, see alignment E=2.9e-10 PF00583: Acetyltransf_1" amino acids 47 to 113 (67 residues), 36.2 bits, see alignment E=9.7e-13 PF13508: Acetyltransf_7" amino acids 53 to 130 (78 residues), 31.7 bits, see alignment E=2.4e-11

Best Hits

KEGG orthology group: K03824, putative acetyltransferase [EC: 2.3.1.-] (inferred from 99% identity to dvl:Dvul_1022)

Predicted SEED Role

"acetyltransferase, GNAT family"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q729Y0 at UniProt or InterPro

Protein Sequence (168 amino acids)

>DVU2217 acetyltransferase, GNAT family (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MVASMIVREEVPEDIGSIFEVTAKAFATLDISDKREPYVIEALRHAGALSLSLVAVFDGR
VIGHVAFSPVAVSDGTEGWFGLGPLSVHPAYPRRGVGTALVREGLARLQSLGAAGCCLVG
HPTYYVRFGFMNAPGLNVEGVPPEYLFAMPFKGEVPKGVVTFHEAFEV