Protein Info for DVU2209 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: conserved hypothetical protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 240 PF10294: Methyltransf_16" amino acids 66 to 205 (140 residues), 60.2 bits, see alignment E=9.2e-20 PF05175: MTS" amino acids 70 to 155 (86 residues), 39.4 bits, see alignment E=2.1e-13 PF06325: PrmA" amino acids 80 to 157 (78 residues), 31.3 bits, see alignment E=6.3e-11 PF13847: Methyltransf_31" amino acids 85 to 169 (85 residues), 34.1 bits, see alignment E=8.2e-12 PF13649: Methyltransf_25" amino acids 89 to 178 (90 residues), 35.6 bits, see alignment E=5e-12 PF08241: Methyltransf_11" amino acids 89 to 178 (90 residues), 27.3 bits, see alignment E=1.9e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU2209)

Predicted SEED Role

"Hepatocellular carcinoma-associated antigen HCA557b"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q729Y8 at UniProt or InterPro

Protein Sequence (240 amino acids)

>DVU2209 conserved hypothetical protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MHTDTPSLESLLEAARQRYDVVFEPLTVDETPLDVLQIRNMRQHIDALVANRSVRDPLHD
LPLWAKIWPASFVLGRFLRKASPEGRTLLEVGAGCGVTGLIASRYGFAHVTVSDINEDAL
LFARANVLKNGLEDRVSVRRVDVASTRLDEKFDVIAASEVLYLEELHRPLIKFLLRHLAR
REDAVAMLCTDTRRKMGRFFKQAERDFRIEEQLVGIRTTGDDGEEERRVFTIHRLHHKHP