Protein Info for DVU2204 in Desulfovibrio vulgaris Hildenborough JW710

Name: tnaA
Annotation: tryptophanase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01212: Beta_elim_lyase
  • amino acids 46 to 427 (382 residues), 298.5 bits, E=5.1e-93
• PF00155: Aminotran_1_2
  • amino acids 69 to 220 (152 residues), 28.2 bits, E=1.1e-10

Best Hits

Swiss-Prot: 100% identical to TNAA_DESVV: Tryptophanase (tnaA) from Desulfovibrio vulgaris subsp. vulgaris (strain DP4)

KEGG orthology group: K01667, tryptophanase [EC: 4.1.99.1] (inferred from 100% identity to dvl:Dvul_1032)

MetaCyc: 77% identical to tryptophanase subunit (Klebsiella aerogenes)
Tryptophanase. [EC: 4.1.99.1]

Predicted SEED Role

"Tryptophanase (EC 4.1.99.1)" in subsystem Aromatic amino acid degradation (EC 4.1.99.1)

MetaCyc Pathways

• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• L-serine degradation (3/3 steps found)
• L-tryptophan degradation II (via pyruvate) (3/3 steps found)
• D-serine degradation (2/3 steps found)
• L-cysteine degradation II (2/3 steps found)
• L-methionine biosynthesis II (4/6 steps found)
• glycine betaine degradation III (4/7 steps found)
• purine nucleobases degradation II (anaerobic) (16/24 steps found)
• felinine and 3-methyl-3-sulfanylbutan-1-ol biosynthesis (2/5 steps found)
• L-mimosine degradation (4/8 steps found)
• glycine betaine degradation I (4/8 steps found)
• glutathione-mediated detoxification I (2/8 steps found)

KEGG Metabolic Maps

• Nitrogen metabolism
• Tryptophan metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.99.1

Sequence Analysis Tools

See Q729Z3 at UniProt or InterPro

Protein Sequence (462 amino acids)

>DVU2204 tryptophanase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MKRIPEPFRIKMIEPIRMTTLEDRTRALEEAGYNPFLLKSEDVYIDLLTDSGTGAMSDRQ
WAGLMMGDEAYAGSRNFLNLEKAVKDVFGYEHTVPTHQGRGAEQILFPCLVARMKGDKPV
FISNYHFDTTAAHVEMTGAKAINVVTEKAFDTGTYYDWKGDFDLEKLEATIRQHGAQNVA
GIIVTITCNSAGGQPVSMANIREAAAIAKRHGITVIIDSARFCENAWFIKQREAGYADKS
IREIIREMYSYGDVLTCSAKKDPIVNIGGLCCIKEDVDLFRAVQVRCVPMEGFVTYGGLA
GRDMEALAIGLYEGTDEHFLTYRIKQVEYLGERLRQGGVPIQYPTGGHAVFIDAKLMLPH
IPGNQFPAHALANEVYIEGGVRGVEIGSLLLGRDPATGLQKESPLELLRLAIPRRVYTND
HMDYIADTVIAVLDRASSIKGLEFTYEPPVLRHFTARLRPIA