Protein Info for DVU2188 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: primase, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 830 PF01807: Zn_ribbon_DnaG" amino acids 31 to 69 (39 residues), 27.3 bits, see alignment 8.8e-10 PF13662: Toprim_4" amino acids 243 to 317 (75 residues), 29.6 bits, see alignment E=2.2e-10 PF13155: Toprim_2" amino acids 245 to 321 (77 residues), 39.4 bits, see alignment E=2.3e-13 PF08706: D5_N" amino acids 408 to 537 (130 residues), 61.1 bits, see alignment E=5.3e-20 TIGR01613: phage/plasmid primase, P4 family, C-terminal domain" amino acids 487 to 786 (300 residues), 201 bits, see alignment E=9.8e-64 PF01057: Parvo_NS1" amino acids 554 to 667 (114 residues), 19.5 bits, see alignment E=1.5e-07 PF19263: DUF5906" amino acids 566 to 675 (110 residues), 71.3 bits, see alignment E=3.9e-23 PF03288: Pox_D5" amino acids 741 to 794 (54 residues), 23.1 bits, see alignment 3e-08

Best Hits

KEGG orthology group: K06919, putative DNA primase/helicase (inferred from 100% identity to dvu:DVU2188)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72A09 at UniProt or InterPro

Protein Sequence (830 amino acids)

>DVU2188 primase, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MGWAGRNLSRDQRDAIARKLFTVTDEEDNWLNGLCPLHDDQNQSFSYNVDEDVFHCFRQC
VEDGDLVDLYCHVRGLPLRSGEGFKAFRREFAADAGVGQPARRTPGETRKHEAASQKGAA
KRSPRQNLEIPEAVYEAMTPVTPDWAARLYTQRGWTPEVMTTYGVRLLSHFRKKSDLYAV
FPLKTIDRVVIPVRDAQGVLRNLRCYHALGKPPGDQPKIYSWGRGHGASMLFPPASMLRP
GGVLLCEGEGDCLCAFSHGVRNAITQTGKPNEWPEDHAEALAGRDVVIAYDADQAGQKYA
EAAAKNLVRKGCAVRIIRWPAFMGLREDGSWPEDHGQDLTDFFVRHRKTLSDFMLLLDDA
QPYVPAGKAGASPDAGDDAPPAGADPNAPYMRFFGMSANGRFTFRERILADYLCQENPMM
YHDKSGQLFVWNGKHFEIYSDEQLKRRAINALGEEATAARVASCSSLAMTMSAIPHGRSL
NDRDDWLCIENGMLNVTTLELAPHDRDYLATIMLPVRYDSETTPKPERWLTFLAETIQTE
GPIAQLQEFMGYCLTRQTKFDKCLLLLGPGSDGKSKVIKVLRAMVGEANCSAVSMTGLED
QFQRSALFGKLLNVGTEVTTAALESEYFKAIVTGDPIQASFKHKDSFEFTPCVKLVYAAN
KLPRVMDNSDGYFRRILPIQFKRQFLENDPAMDPDLEGKLMAELDGIFEWALVGLHRLLA
QGRFTMCDETRDILMDYRRFNNPVLGFVQDRCTITDNTRTDIKDLYADFKRYASENGFKQ
LNRENFMRELETAARKVREDAAVRVTRPRAANGARPYLVENITLNPVVIE