Protein Info for DVU2142 in Desulfovibrio vulgaris Hildenborough JW710

Name: surE
Annotation: stationary-phase survival protein SurE (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00087: 5'/3'-nucleotidase SurE
  • amino acids 1 to 237 (237 residues), 201.5 bits, E=7.5e-64
• PF01975: SurE
  • amino acids 3 to 187 (185 residues), 202.3 bits, E=3.2e-64

Best Hits

Swiss-Prot: 100% identical to SURE_DESVH: 5'-nucleotidase SurE (surE) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K03787, 5'-nucleotidase [EC: 3.1.3.5] (inferred from 100% identity to dvl:Dvul_1090)

Predicted SEED Role

"5-nucleotidase SurE (EC 3.1.3.5)" in subsystem Folate Biosynthesis (EC 3.1.3.5)

MetaCyc Pathways

• inosine 5'-phosphate degradation (4/4 steps found)
• purine nucleotides degradation II (aerobic) (9/11 steps found)
• adenosine nucleotides degradation II (4/5 steps found)
• guanosine nucleotides degradation III (3/4 steps found)
• UTP and CTP dephosphorylation I (5/7 steps found)
• NAD salvage pathway III (to nicotinamide riboside) (2/3 steps found)
• adenosine nucleotides degradation I (5/8 steps found)
• guanosine nucleotides degradation I (2/4 steps found)
• guanosine nucleotides degradation II (2/4 steps found)
• ureide biosynthesis (4/7 steps found)
• superpathway of guanosine nucleotides degradation (plants) (2/6 steps found)
• purine nucleotides degradation I (plants) (6/12 steps found)
• NAD salvage (plants) (4/11 steps found)
• tunicamycin biosynthesis (1/9 steps found)
• superpathway of purines degradation in plants (6/18 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Nicotinate and nicotinamide metabolism
• Purine metabolism
• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.5

Sequence Analysis Tools

See Q72A55 at UniProt or InterPro

Protein Sequence (250 amino acids)

>DVU2142 stationary-phase survival protein SurE (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MRIALTNDDGIQAPGLRAIYKALIEAGHTVDVVAPVTEQSAVGHAVTIAMPLRVKVFHEN
GFRGHGVYGTPTDCMKLGLSSLLEHKPELVVSGINAGANVGPDILYSGTVSAATEAAHMG
YRAVALSYDSFRPEDISAHARHAAALLPHIEWAGLPERCVVNINYPAVPVESIKGVRVCP
QTRAVWHDWYEHRTDPRGGSYWWLNGVIPPETVAPGTDRALLTEGYITVTPLRFDFTDSE
TLTRLASLEE