Protein Info for DVU2125 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: TPR domain protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 371 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details PF13181: TPR_8" amino acids 72 to 104 (33 residues), 13.6 bits, see alignment 4e-05 amino acids 140 to 172 (33 residues), 19.1 bits, see alignment 6.8e-07 amino acids 243 to 268 (26 residues), 12.6 bits, see alignment (E = 8.3e-05) PF14559: TPR_19" amino acids 83 to 146 (64 residues), 26.9 bits, see alignment E=3e-09 PF13432: TPR_16" amino acids 110 to 172 (63 residues), 40.5 bits, see alignment E=1.8e-13 amino acids 184 to 239 (56 residues), 24.7 bits, see alignment 1.5e-08 amino acids 248 to 302 (55 residues), 20.6 bits, see alignment 2.9e-07

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvl:Dvul_1106)

Predicted SEED Role

"Flp pilus assembly protein TadD, contains TPR repeat" in subsystem Widespread colonization island

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72A72 at UniProt or InterPro

Protein Sequence (371 amino acids)

>DVU2125 TPR domain protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSITATHDTSSKGRHALPALALLLLMTLSGCAARDMGDGTSPSLMERHATGKSLAPDAPG
TPQRQGTPAAEAEAHLQRGLAYLAQDRPELAFEHFSRAASLAPEMVEPRLQRARLLVRRG
MPNEAAADIEAVLAASPQHARAWELAGMVAFDRGLLDEAEADFTRAITLDPDLASCYAHL
GAVHDYKGRPDLARDVYAAALVRFPQSGELHNNLGVAFSMLGDDASALHHFHEAVVLGAS
SERSWNNMGLALCRLGRFDEAFEAFRNAGGEAAAHNNLGYFFLVNGDASLAVQHLQRAVE
LEPRYYVRAAENLKRARLAARFAAGGVPVPAAGPQTGGIAGTPVNKAGVLPPATGKGPGT
RTTGAGERVIQ