Protein Info for DVU2109 in Desulfovibrio vulgaris Hildenborough JW710

Name: mrp
Annotation: MTH1175-like domain family protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 487 PF10609: ParA" amino acids 74 to 318 (245 residues), 306.1 bits, see alignment E=4.4e-95 PF09140: MipZ" amino acids 78 to 122 (45 residues), 29.3 bits, see alignment 1.3e-10 PF13614: AAA_31" amino acids 79 to 114 (36 residues), 32.3 bits, see alignment 2.3e-11 PF01656: CbiA" amino acids 79 to 250 (172 residues), 45.6 bits, see alignment E=1.6e-15 PF02579: Nitro_FeMo-Co" amino acids 384 to 469 (86 residues), 63.5 bits, see alignment E=4.6e-21

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU2109)

Predicted SEED Role

"Cytosolic Fe-S cluster assembling factor NBP35"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72A88 at UniProt or InterPro

Protein Sequence (487 amino acids)

>DVU2109 MTH1175-like domain family protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSTVNGANIQSEEQHTGGCSAGCSGGSTGGSTDGSTGGNTQQGCSCDTHDEQRDGSVAAQ
TFGEEGPVKTLGRIGSKLVVLSGKGGVGKSTVAVNLAVGLARAGRKVGLLDVDVHGPSVP
RLLGLTGTRPMIGEDAMYPVGWRNNLRVMSLGFFLPDPEQAVIWRGPVKMGLIRHFLTEV
RWGDLDHLVVDCPPGTGDEPLSVLQLLGTDAQAVIVTTPQGVAVDDVRRSVGFCRELGNP
ILGIVENMGGYVCPKCGELTPLFPAGGGEALAAEQGVTFLGRIPLHPDLTSAGDAGRSLY
EADAAHPIVRALAPIVERAAATLHASDIRHESTTGPQSEAAPGTGKTAATMPTAPTRNES
CAPATNHPDTNGDTTMKIAIPVAGDVLCQHFGHCERFALIDVDPATGSVTGRNDVTPPPH
EPGLLPVWLSEKGANLVIAGGMGARARALLEERGVKVLIGAPAAAPEAIVAAHMAGTLTL
GANTCDH