Protein Info for DVU2079 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: sensory box histidine kinase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 811 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details transmembrane" amino acids 351 to 375 (25 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 385 to 511 (127 residues), 47.6 bits, see alignment E=8.8e-17 PF13188: PAS_8" amino acids 388 to 444 (57 residues), 34.9 bits, see alignment 2.1e-12 PF00989: PAS" amino acids 389 to 489 (101 residues), 24.8 bits, see alignment E=3.6e-09 PF02518: HATPase_c" amino acids 688 to 796 (109 residues), 82.8 bits, see alignment E=5e-27

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU2079)

Predicted SEED Role

"sensory box histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72AB8 at UniProt or InterPro

Protein Sequence (811 amino acids)

>DVU2079 sensory box histidine kinase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSWLVSPFRISVLRSLVLAWTIMLCFVAAVALAQVQARPHVLLLNSYHQGFRWTDEVVQA
VRGTLASASPVEIHVEYMDAKRIESPDYLDQYADLLRRKYTGLRLSVVAASDDPAFDFVL
RHRGLFGDAPVVFCGTNDITPDRLRGESGVVGVTETVDYEGGLALALRLHPGVRQILVVV
DDTSTGRLVRERLEGVRRSLPPGVSLHFSPTSSLGAVLDVARTTGADTLIFLTIFNRDDA
GRFYEYDEVPRLLSEASRSPVYGAWDFYLGDGIVGGVLTSGEAQGKTAAELVLEVLKRGG
TTGLPLISRSPNKFMFDYRQLQRFGIRPDRLPKDSIVVNRPVGFYEQNRPLVHTVVGAFV
LLSGFTVSLLVNVVARKRAEAALRVSEARLRGIFENAGEGIFRVTLEGRILMVNPAMARI
LRYDSVEDLIRVTDAGAHVLYRDAGWRERYVARLMQYGVVRDFEARMAARTGEDVWVSIS
SRLVVDEEDGTTIIEGIMADTTARKEAELALQAMNVSLEARVSERTAELARANDALQKSM
DELRAMQARIVEQEKFAALGGLVAGVAHEMNTPVGVCITSASFLADKVRGLRSEVEGGSI
RRSELLDFMSRAEEASQTLVANLGRTAELVRAFKQLAVDEAGTNARTIELCPFIDDILGG
LRPICEQAGHRLDYECDACGVQMHVAPPALAQVVGHLVRNSLDHAFPTGGAGRMQLKVSC
PEGGVELTFSDDGVGMGTDVLSHIFEPFFTTRRQAGATGLGLHLVYNTVTRTLGGTIECT
SAPGEGACFRIRLPLSDPCRDTPAEVGCEPV