Protein Info for DVU1993 in Desulfovibrio vulgaris Hildenborough JW710

Name: ctpF
Annotation: cation-transporting ATPase, E1-E2 family (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 917 transmembrane" amino acids 58 to 80 (23 residues), see Phobius details amino acids 86 to 102 (17 residues), see Phobius details amino acids 249 to 268 (20 residues), see Phobius details amino acids 275 to 303 (29 residues), see Phobius details amino acids 715 to 740 (26 residues), see Phobius details amino acids 747 to 766 (20 residues), see Phobius details amino acids 787 to 806 (20 residues), see Phobius details amino acids 818 to 836 (19 residues), see Phobius details amino acids 856 to 875 (20 residues), see Phobius details amino acids 883 to 904 (22 residues), see Phobius details PF00690: Cation_ATPase_N" amino acids 9 to 76 (68 residues), 64.5 bits, see alignment 1.6e-21 TIGR01494: HAD ATPase, P-type, family IC" amino acids 88 to 194 (107 residues), 63.6 bits, see alignment E=6e-22 amino acids 216 to 351 (136 residues), 97.1 bits, see alignment E=4.3e-32 amino acids 623 to 745 (123 residues), 125 bits, see alignment E=1.4e-40 PF00122: E1-E2_ATPase" amino acids 120 to 229 (110 residues), 93.2 bits, see alignment E=2.4e-30 PF00702: Hydrolase" amino acids 327 to 668 (342 residues), 50.8 bits, see alignment E=8.4e-17 PF13246: Cation_ATPase" amino acids 399 to 557 (159 residues), 112.2 bits, see alignment E=7.8e-36 PF08282: Hydrolase_3" amino acids 644 to 693 (50 residues), 22.8 bits, see alignment 2.1e-08 PF00689: Cation_ATPase_C" amino acids 739 to 909 (171 residues), 164.5 bits, see alignment E=6.5e-52

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvl:Dvul_1180)

Predicted SEED Role

"Ca ion P-type ATPase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72AJ9 at UniProt or InterPro

Protein Sequence (917 amino acids)

>DVU1993 cation-transporting ATPase, E1-E2 family (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MDSLTGKLWHHLSAEKATEALQTDPQKGLDTFEVQRRAVEFGPNALTGRRGKTPLERFLL
QFHQPLIYVLLLSGLITAVLGEVVDSSVIIGVVLVNAIVGYIQEAKAAGALEALARSMVA
EAEVVRSGGVRRIGAVDLVPGDVVLLRSGDKVPADLRLVTVKDLRVDESALTGESVPVSK
AVGTLPRETVLADRTNMAYASALVTYGTATGVVVATGDHTEIGRISTMVHEADTLATPLT
RRIEKFSHLLLWAIMALAVLTFVAGVARGEKAAEMFMAAVALAVGAIPEGLPAAVTVILA
IGVSRMASRGAIIRNLPAVETLGGASVICSDKTGTLTENRMTVTALYAAGRRYAVTGTGY
RPTGDIMPSGEGYAPAGDDAHRGLAMAELSGRKALFATLLGGALCNDTRIEATPEGDKVE
GDPTEAALLVVAAKAGIHVADALRTAPRADALPFESEHQYMATLHHGEAGPVVYVKGSVE
AVLSRADRMLLDDGTLVPLDVAAFREEVERMAVQGLRVLALAQRVDGVGVAHLTHDDVAS
GLVVVGLQGMIDPPRAEAVAAVAAFHGAGVKVKMITGDHAVTAAAIGKQIGLGDAGCPGD
PACKVLTGAQLAGLTDDELVRHAAETSIFARVAPEQKLRLVMALQSRGEVVAMTGDGVND
APALKQADIGVAMGHGGTEAAKEASDMVLTDDNFATIKAAVEEGRGVYDNLLKFIVWTLP
TNLGEGLVILVAVLLGMALPILPVQILWINMTTASILGIMLAFEPMEPGLMQRKPRDPAH
PILDRELFRRIVLVGSLLLVSAFGLYKFELAQGHTQEAARTVAVNVFVLVQTFYLFNSRS
FTRSPFELGIMSNPWTLLGAACMIVLQVAFTYVPVMNGLFGSAPIGLGAWLRILGVSVLA
YGVVEADKKLRARGALK