Protein Info for DVU1984 in Desulfovibrio vulgaris Hildenborough JW710

Name: msrA
Annotation: peptide methionine sulfoxide reductase MsrA (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 208 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF01625: PMSR" amino acids 39 to 205 (167 residues), 230.1 bits, see alignment E=8.8e-73 TIGR00401: peptide-methionine (S)-S-oxide reductase" amino acids 39 to 187 (149 residues), 187 bits, see alignment E=1.3e-59

Best Hits

Swiss-Prot: 49% identical to MSRA2_RHIME: Peptide methionine sulfoxide reductase MsrA 2 (msrA2) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K07304, peptide-methionine (S)-S-oxide reductase [EC: 1.8.4.11] (inferred from 100% identity to dvu:DVU1984)

Predicted SEED Role

"Peptide methionine sulfoxide reductase MsrA (EC 1.8.4.11)" (EC 1.8.4.11)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72AK8 at UniProt or InterPro

Protein Sequence (208 amino acids)

>DVU1984 peptide methionine sulfoxide reductase MsrA (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MTAIETLLLTGLLLATALLPPALAHAAQPAPPPPAGMQVAVFAGGCFWCMEKPFDAVEGV
LETTSGYTGGTVESPTYEQVSNGGTGHAEALRVVYDPAKVSYTALLDTFWHNVDPFDAGG
QFCDRGSQYRSAIFPQDASQRADAESSLKALEERFGRPVATRIEPAGAFWPAEEYHQDYY
KKNPLRYSFYRSNCGRDRKLKEVWGSPK