Protein Info for DVU1978 in Desulfovibrio vulgaris Hildenborough JW710

Name: metT
Annotation: methionine transporter from the Na+/H+ antiporter superfamily (Dmitry Rodionov)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 26 to 27 (2 residues), see Phobius details amino acids 35 to 55 (21 residues), see Phobius details amino acids 67 to 93 (27 residues), see Phobius details amino acids 114 to 141 (28 residues), see Phobius details amino acids 153 to 174 (22 residues), see Phobius details amino acids 195 to 215 (21 residues), see Phobius details amino acids 235 to 267 (33 residues), see Phobius details amino acids 286 to 313 (28 residues), see Phobius details amino acids 334 to 358 (25 residues), see Phobius details amino acids 378 to 404 (27 residues), see Phobius details amino acids 413 to 433 (21 residues), see Phobius details PF03553: Na_H_antiporter" amino acids 20 to 215 (196 residues), 40.5 bits, see alignment E=1e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvl:Dvul_1194)

Predicted SEED Role

"Methionine transporter MetT" in subsystem Methionine Biosynthesis or Methionine Degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72AL4 at UniProt or InterPro

Protein Sequence (440 amino acids)

>DVU1978 methionine transporter from the Na+/H+ antiporter superfamily (Dmitry Rodionov) (Desulfovibrio vulgaris Hildenborough JW710)
MEQKTNGLALLPLALFLVLFIGTGSILSFTGVKMAFYELSPAVAILPALALALIMGHGGL
SKKINIMLAGAGEINIITMCVIYLLAGGFASVAKAIGGVDATVNLGLSLIPAEFILPGLF
LIAAFVSTAMGTSMGTIAAVGPIAVGIGQQTDIGLAMLMGSVVGGAMFGDNLSMISDTTI
AATRTQGCEMGDKFRMNLLIALPAAVGATLLFWLMGDSGQAARVGAWEMARVLPYVVILA
MALAGMNVFVVLFTGIVLAGGVGVAVVPGYSVLQWAKDIYAGFSGMHEILVLSMLMGGLG
ELIRYQGGLAWLLERIGRMTSDRRDGRTRRLGEAGISLLVSLANLCTANNTVAIILTGGM
ARGLAETNGVDPRRSASMLDIFSCVVQGLIPYGAQVLLAGSIAGISPVDVSLSNMYCYLL
CVAALASIALGLPKGGRKVA